Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07458
Secondary Accession Numbers
  • 13166
Name Arylsulfatase G
Synonyms
  1. ASG
Gene Name ARSG
Protein Type Unknown
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Displays arylsulfatase activity at acidic pH with pseudosubstrates, such as p-nitrocatechol sulfate and also, but with lower activity, p-nitrophenyl sulfate and 4- methylumbelliferyl sulfate
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
sulfuric ester hydrolase activity
Process
metabolic process
Cellular Location
  1. Lysosome
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24.2
SNPs ARSG
Gene Sequence
>1578 bp
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTAT
CCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAAGCCAAACTTTGTGATT
ATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCT
GCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAAT
GGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTT
GGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCA
TATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCC
CTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCC
CAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCA
GCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTG
GGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACT
GGATTTTGGCAAACTCGTCAAGGGGGAAGTCCAGCCAAGCAGACGACCTGGGAAGGAGGG
CACCGGGTCCCAGCACTGGCTTACTGGCCTGGCAGAGTTCCAGTTAATGTCACCAGCACT
GCCTTGTTAAGCGTGCTGGACATTTTTCCAACTGTGGTAGCCCTGGCCCAGGCCAGCTTA
CCTCAAGGACGGCGCTTTGATGGTGTGGACGTCTCCGAGGTGCTCTTTGGCCGGTCACAG
CCTGGGCACAGGGTGCTGTTCCACCCCAACAGCGGGGCAGCTGGAGAGTTTGGAGCCCTG
CAGACTGTCCGCCTGGAGCGTTACAAGGCCTTCTACATTACCGGTGGAGCCAGGGCGTGT
GATGGGAGCACGGGGCCTGAGCTGCAGCATAAGTTTCCTCTGATTTTCAACCTGGAAGAC
GATACCGCAGAAGCTGTGCCCCTAGAAAGAGGTGGTGCGGAGTACCAGGCTGTGCTGCCC
GAGGTCAGAAAGGTTCTTGCAGACGTCCTCCAAGACATTGCCAACGACAACATCTCCAGC
GCAGATTACACTCAGGACCCTTCAGTAACTCCCTGCTGTAATCCCTACCAAATTGCCTGC
CGCTGTCAAGCCGCATAA
Protein Properties
Number of Residues 525
Molecular Weight 57060.2
Theoretical pI 6.62
Pfam Domain Function
Signals
  • 1-16
Transmembrane Regions
  • None
Protein Sequence
>Arylsulfatase G
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKD
TANLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETT
LAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRP
FLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFT
GDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTST
ALLSVLDIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGAL
QTVRLERYKAFYITGGARACDGSTGPELQHKFPLIFNLEDDTAEAVPLERGGAEYQAVLP
EVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA
GenBank ID Protein 45430057
UniProtKB/Swiss-Prot ID Q96EG1
UniProtKB/Swiss-Prot Entry Name ARSG_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014960.3
GeneCard ID ARSG
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  4. Ferrante P, Messali S, Meroni G, Ballabio A: Molecular and biochemical characterisation of a novel sulphatase gene: Arylsulfatase G (ARSG). Eur J Hum Genet. 2002 Dec;10(12):813-8. [PubMed:12461688 ]
  5. Frese MA, Schulz S, Dierks T: Arylsulfatase G, a novel lysosomal sulfatase. J Biol Chem. 2008 Apr 25;283(17):11388-95. doi: 10.1074/jbc.M709917200. Epub 2008 Feb 18. [PubMed:18283100 ]