You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07459
Secondary Accession Numbers
  • 13167
Name Arylsulfatase I
Synonyms
  1. ASI
Gene Name ARSI
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Displays arylsulfatase activity at neutral pH, when co- expressed with SUMF1; arylsulfatase activity is measured in the secretion medium of retinal cell line, but no activity is recorded when measured in cell extracts
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
sulfuric ester hydrolase activity
Process
metabolic process
Cellular Location
  1. Secreted
  2. Endoplasmic reticulum
Gene Properties
Chromosome Location Chromosome:5
Locus 5q32
SNPs ARSI
Gene Sequence
>1710 bp
ATGCACACCCTCACTGGCTTCTCCCTGGTCAGCCTGCTCAGCTTCGGCTACCTGTCCTGG
GACTGGGCCAAGCCGAGCTTCGTGGCCGACGGGCCCGGGGAGGCTGGCGAGCAGCCCTCG
GCCGCTCCGCCCCAGCCTCCCCACATCATCTTCATCCTCACGGACGACCAAGGCTACCAC
GACGTGGGCTACCATGGTTCAGATATCGAGACCCCTACGCTGGACAGGCTGGCGGCCAAG
GGGGTCAAGTTGGAGAATTATTACATCCAGCCCATCTGCACGCCTTCGCGGAGCCAGCTC
CTCACTGGCAGGTACCAGATCCACACAGGACTCCAGCATTCCATCATCCGCCCACAGCAG
CCCAACTGCCTGCCCCTGGACCAGGTGACACTGCCACAGAAGCTGCAGGAGGCAGGTTAT
TCCACCCATATGGTGGGCAAGTGGCACCTGGGCTTCTACCGGAAGGAGTGTCTGCCCACC
CGTCGGGGCTTCGACACCTTCCTGGGCTCGCTCACGGGCAATGTGGACTATTACACCTAT
GACAACTGTGATGGCCCAGGCGTGTGCGGCTTCGACCTGCACGAGGGTGAGAATGTGGCC
TGGGGGCTCAGCGGCCAGTACTCCACTATGCTTTACGCCCAGCGCGCCAGCCATATCCTG
GCCAGCCACAGCCCTCAGCGTCCCCTCTTCCTCTATGTGGCCTTCCAGGCAGTACACACA
CCCCTGCAGTCCCCTCGTGAGTACCTGTACCGCTACCGCACCATGGGCAATGTGGCCCGG
CGGAAGTACGCGGCCATGGTGACCTGCATGGATGAGGCTGTGCGCAACATCACCTGGGCC
CTCAAGCGCTACGGTTTCTACAACAACAGTGTCATCATCTTCTCCAGTGACAATGGTGGC
CAGACTTTCTCGGGGGGCAGCAACTGGCCGCTCCGAGGACGCAAGGGCACTTATTGGGAA
GGTGGCGTGCGGGGCCTAGGCTTTGTCCACAGTCCCCTGCTCAAGCGAAAGCAACGGACA
AGCCGGGCACTGATGCACATCACTGACTGGTACCCGACCCTGGTGGGTCTGGCAGGTGGT
ACCACCTCAGCAGCCGATGGGCTAGATGGCTACGACGTGTGGCCGGCCATCAGCGAGGGC
CGGGCCTCACCACGCACGGAGATCCTGCACAACATTGACCCACTCTACAACCATGCCCAG
CATGGCTCCCTGGAGGGCGGCTTTGGCATCTGGAACACCGCCGTGCAGGCTGCCATCCGC
GTGGGTGAGTGGAAGCTGCTGACAGGAGACCCCGGCTATGGCGATTGGATCCCACCGCAG
ACACTGGCCACCTTCCCGGGTAGCTGGTGGAACCTGGAACGAATGGCCAGTGTCCGCCAG
GCCGTGTGGCTCTTCAACATCAGTGCTGACCCTTATGAACGGGAGGACCTGGCTGGCCAG
CGGCCTGATGTGGTCCGCACCCTGCTGGCTCGCCTGGCCGAATATAACCGCACAGCCATC
CCGGTACGCTACCCAGCTGAGAACCCCCGGGCTCATCCTGACTTTAATGGGGGTGCTTGG
GGGCCCTGGGCCAGTGATGAGGAAGAGGAGGAAGAGGAAGGGAGGGCTCGAAGCTTCTCC
CGGGGTCGTCGCAAGAAAAAATGCAAGATTTGCAAGCTTCGATCCTTTTTCCGTAAACTC
AACACCAGGCTAATGTCCCAACGGATCTGA
Protein Properties
Number of Residues 569
Molecular Weight 64029.8
Theoretical pI 8.75
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Arylsulfatase I
MHTLTGFSLVSLLSFGYLSWDWAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYH
DVGYHGSDIETPTLDRLAAKGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPQQ
PNCLPLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTY
DNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHT
PLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNGG
QTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKQRTSRALMHITDWYPTLVGLAGG
TTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHAQHGSLEGGFGIWNTAVQAAIR
VGEWKLLTGDPGYGDWIPPQTLATFPGSWWNLERMASVRQAVWLFNISADPYEREDLAGQ
RPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEEEEEGRARSFS
RGRRKKKCKICKLRSFFRKLNTRLMSQRI
GenBank ID Protein 220983388
UniProtKB/Swiss-Prot ID Q5FYB1
UniProtKB/Swiss-Prot Entry Name ARSI_HUMAN
PDB IDs Not Available
GenBank Gene ID AB448735
GeneCard ID ARSI
GenAtlas ID ARSI
HGNC ID HGNC:32521
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sardiello M, Annunziata I, Roma G, Ballabio A: Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship. Hum Mol Genet. 2005 Nov 1;14(21):3203-17. Epub 2005 Sep 20. [PubMed:16174644 ]
  4. Obaya AJ: Molecular cloning and initial characterization of three novel human sulfatases. Gene. 2006 May 10;372:110-7. Epub 2006 Feb 24. [PubMed:16500042 ]
  5. Oshikawa M, Usami R, Kato S: Characterization of the arylsulfatase I (ARSI) gene preferentially expressed in the human retinal pigment epithelium cell line ARPE-19. Mol Vis. 2009;15:482-94. Epub 2009 Mar 6. [PubMed:19262745 ]