You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07471
Secondary Accession Numbers
  • 13179
Name B2 bradykinin receptor
Synonyms
  1. B2R
  2. BK-2 receptor
Gene Name BDKRB2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
bradykinin receptor activity
receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.1-q32.2
SNPs BDKRB2
Gene Sequence
>1176 bp
ATGTTCTCTCCCTGGAAGATATCAATGTTTCTGTCTGTTCGTGAGGACTCCGTGCCCACC
ACGGCCTCTTTCAGCGCCGACATGCTCAATGTCACCTTGCAAGGGCCCACTCTTAACGGG
ACCTTTGCCCAGAGCAAATGCCCCCAAGTGGAGTGGCTGGGCTGGCTCAACACCATCCAG
CCCCCCTTCCTCTGGGTGCTGTTCGTGCTGGCCACCCTAGAGAACATCTTTGTCCTCAGC
GTCTTCTGCCTGCACAAGAGCAGCTGCACGGTGGCAGAGATCTACCTGGGGAACCTGGCC
GCAGCAGACCTGATCCTGGCCTGCGGGCTGCCCTTCTGGGCCATCACCATCTCCAACAAC
TTCGACTGGCTCTTTGGGGAGACGCTCTGCCGCGTGGTGAATGCCATTATCTCCATGAAC
CTGTACAGCAGCATCTGTTTCCTGATGCTGGTGAGCATCGACCGCTACCTGGCCCTGGTG
AAAACCATGTCCATGGGCCGGATGCGCGGCGTGCGCTGGGCCAAGCTCTACAGCTTGGTG
ATCTGGGGGTGTACGCTGCTCCTGAGCTCACCCATGCTGGTGTTCCGGACCATGAAGGAG
TACAGCGATGAGGGCCACAACGTCACCGCTTGTGTCATCAGCTACCCATCCCTCATCTGG
GAAGTGTTCACCAACATGCTCCTGAATGTCGTGGGCTTCCTGCTGCCCCTGAGTGTCATC
ACCTTCTGCACGATGCAGATCATGCAGGTGCTGCGGAACAACGAGATGCAGAAGTTCAAG
GAGATCCAGACGGAGAGGAGGGCCACGGTGCTAGTCCTGGTTGTGCTGCTGCTATTCATC
ATCTGCTGGCTGCCCTTCCAGATCAGCACCTTCCTGGATACGCTGCATCGCCTCGGCATC
CTCTCCAGCTGCCAGGACGAGCGCATCATCGATGTAATCACACAGATCGCCTCCTTCATG
GCCTACAGCAACAGCTGCCTCAACCCACTGGTGTACGTGATCGTGGGCAAGCGCTTCCGA
AAGAAGTCTTGGGAGGTGTACCAGGGAGTGTGCCAGAAAGGGGGCTGCAGGTCAGAACCC
ATTCAGATGGAGAACTCCATGGGCACACTGCGGACCTCCATCTCCGTGGAACGCCAGATT
CACAAACTGCAGGACTGGGCAGGGAGCAGACAGTGA
Protein Properties
Number of Residues 391
Molecular Weight 44460.2
Theoretical pI 8.2
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 61-84
  • 94-118
  • 132-153
  • 176-198
  • 222-248
  • 268-292
  • 312-335
Protein Sequence
>B2 bradykinin receptor
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
GenBank ID Protein 14194396
UniProtKB/Swiss-Prot ID P30411
UniProtKB/Swiss-Prot Entry Name BKRB2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF378542
GeneCard ID BDKRB2
GenAtlas ID BDKRB2
HGNC ID HGNC:1030
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yeh JC, Otte LA, Frangos JA: Regulation of G protein-coupled receptor activities by the platelet-endothelial cell adhesion molecule, PECAM-1. Biochemistry. 2008 Aug 26;47(34):9029-39. doi: 10.1021/bi8003846. Epub 2008 Aug 2. [PubMed:18672896 ]
  3. Hess JF, Borkowski JA, Young GS, Strader CD, Ransom RW: Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor. Biochem Biophys Res Commun. 1992 Apr 15;184(1):260-8. [PubMed:1314587 ]
  4. Powell SJ, Slynn G, Thomas C, Hopkins B, Briggs I, Graham A: Human bradykinin B2 receptor: nucleotide sequence analysis and assignment to chromosome 14. Genomics. 1993 Feb;15(2):435-8. [PubMed:7916737 ]
  5. McIntyre P, Phillips E, Skidmore E, Brown M, Webb M: Cloned murine bradykinin receptor exhibits a mixed B1 and B2 pharmacological selectivity. Mol Pharmacol. 1993 Aug;44(2):346-55. [PubMed:8394991 ]
  6. Eggerickx D, Raspe E, Bertrand D, Vassart G, Parmentier M: Molecular cloning, functional expression and pharmacological characterization of a human bradykinin B2 receptor gene. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1306-13. [PubMed:1329734 ]
  7. Ma JX, Wang DZ, Ward DC, Chen L, Dessai T, Chao J, Chao L: Structure and chromosomal localization of the gene (BDKRB2) encoding human bradykinin B2 receptor. Genomics. 1994 Sep 15;23(2):362-9. [PubMed:7835885 ]
  8. Braun A, Kammerer S, Bohme E, Muller B, Roscher AA: Identification of polymorphic sites of the human bradykinin B2 receptor gene. Biochem Biophys Res Commun. 1995 Jun 6;211(1):234-40. [PubMed:7779090 ]
  9. AbdAlla S, Godovac-Zimmermann J, Braun A, Roscher AA, Muller-Esterl W, Quitterer U: Structure of the bradykinin B2 receptors' amino terminus. Biochemistry. 1996 Jun 11;35(23):7514-9. [PubMed:8652530 ]