Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07476
Secondary Accession Numbers
  • 13184
Name Scavenger receptor cysteine-rich type 1 protein M130
Synonyms
  1. CD163 antigen
  2. Hemoglobin scavenger receptor
  3. Soluble CD163
  4. sCD163
Gene Name CD163
Protein Type Unknown
Biological Properties
General Function Involved in scavenger receptor activity
Specific Function After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
receptor activity
transmembrane receptor activity
scavenger receptor activity
molecular transducer activity
signal transducer activity
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.3
SNPs CD163
Gene Sequence
>3471 bp
ATGAGCAAACTCAGAATGGTGCTACTTGAAGACTCTGGATCTGCTGACTTCAGAAGACAT
TTTGTCAACTTGAGTCCCTTCACCATTACTGTGGTCTTACTTCTCAGTGCCTGTTTTGTC
ACCAGTTCTCTTGGAGGAACAGACAAGGAGCTGAGGCTAGTGGATGGTGAAAACAAGTGT
AGCGGGAGAGTGGAAGTGAAAGTCCAGGAGGAGTGGGGAACGGTGTGTAATAATGGCTGG
AGCATGGAAGCGGTCTCTGTGATTTGTAACCAGCTGGGATGTCCAACTGCTATCAAAGCC
CCTGGATGGGCTAATTCCAGTGCAGGTTCTGGACGCATTTGGATGGATCATGTTTCTTGT
CGTGGGAATGAGTCAGCTCTTTGGGATTGCAAACATGATGGATGGGGAAAGCATAGTAAC
TGTACTCACCAACAAGATGCTGGAGTGACCTGCTCAGATGGATCCAATTTGGAAATGAGG
CTGACGCGTGGAGGGAATATGTGTTCTGGAAGAATAGAGATCAAATTCCAAGGACGGTGG
GGAACAGTGTGTGATGATAACTTCAACATAGATCATGCATCTGTCATTTGTAGACAACTT
GAATGTGGAAGTGCTGTCAGTTTCTCTGGTTCATCTAATTTTGGAGAAGGCTCTGGACCA
ATCTGGTTTGATGATCTTATATGCAACGGAAATGAGTCAGCTCTCTGGAACTGCAAACAT
CAAGGATGGGGAAAGCATAACTGTGATCATGCTGAGGATGCTGGAGTGATTTGCTCAAAG
GGAGCAGATCTGAGCCTGAGACTGGTAGATGGAGTCACTGAATGTTCAGGAAGATTAGAA
GTGAGATTCCAAGGAGAATGGGGGACAATATGTGATGACGGCTGGGACAGTTACGATGCT
GCTGTGGCATGCAAGCAACTGGGATGTCCAACTGCCGTCACAGCCATTGGTCGAGTTAAC
GCCAGTAAGGGATTTGGACACATCTGGCTTGACAGCGTTTCTTGCCAGGGACATGAACCT
GCTGTCTGGCAATGTAAACACCATGAATGGGGAAAGCATTATTGCAATCACAATGAAGAT
GCTGGCGTGACATGTTCTGATGGATCAGATCTGGAGCTAAGACTTAGAGGTGGAGGCAGC
CGCTGTGCTGGGACAGTTGAGGTGGAGATTCAGAGACTGTTAGGGAAGGTGTGTGACAGA
GGCTGGGGACTGAAAGAAGCTGATGTGGTTTGCAGGCAGCTGGGATGTGGATCTGCACTC
AAAACATCTTATCAAGTGTACTCCAAAATCCAGGCAACAAACACATGGCTGTTTCTAAGT
AGCTGTAACGGAAATGAAACTTCTCTTTGGGACTGCAAGAACTGGCAATGGGGTGGACTT
ACCTGTGATCACTATGAAGAAGCCAAAATTACCTGCTCAGCCCACAGGGAACCCAGACTG
GTTGGAGGGGACATTCCCTGTTCTGGACGTGTTGAAGTGAAGCATGGTGACACGTGGGGC
TCCATCTGTGATTCGGACTTCTCTCTGGAAGCTGCCAGCGTTCTATGCAGGGAATTACAG
TGTGGCACAGTTGTCTCTATCCTGGGGGGAGCTCACTTTGGAGAGGGAAATGGACAGATC
TGGGCTGAAGAATTCCAGTGTGAGGGACATGAGTCCCATCTTTCACTCTGCCCAGTAGCA
CCCCGCCCAGAAGGAACTTGTAGCCACAGCAGGGATGTTGGAGTAGTCTGCTCAAGATAC
ACAGAAATTCGCTTGGTGAATGGCAAGACCCCGTGTGAGGGCAGAGTGGAGCTCAAAACG
CTTGGTGCCTGGGGATCCCTCTGTAACTCTCACTGGGACATAGAAGATGCCCATGTTCTT
TGCCAGCAGCTTAAATGTGGAGTTGCCCTTTCTACCCCAGGAGGAGCACGTTTTGGAAAA
GGAAATGGTCAGATCTGGAGGCATATGTTTCACTGCACTGGGACTGAGCAGCACATGGGA
GATTGTCCTGTAACTGCTCTAGGTGCTTCATTATGTCCTTCAGAGCAAGTGGCCTCTGTA
ATCTGCTCAGGAAACCAGTCCCAAACACTGTCCTCGTGCAATTCATCGTCTTTGGGCCCA
ACAAGGCCTACCATTCCAGAAGAAAGTGCTGTGGCCTGCATAGAGAGTGGTCAACTTCGC
CTGGTAAATGGAGGAGGTCGCTGTGCTGGGAGAGTAGAGATCTATCATGAGGGCTCCTGG
GGCACCATCTGTGATGACAGCTGGGACCTGAGTGATGCCCACGTGGTTTGCAGACAGCTG
GGCTGTGGAGAGGCCATTAATGCCACTGGTTCTGCTCATTTTGGGGAAGGAACAGGGCCC
ATCTGGCTGGATGAGATGAAATGCAATGGAAAAGAATCCCGCATTTGGCAGTGCCATTCA
CACGGCTGGGGGCAGCAAAATTGCAGGCACAAGGAGGATGCGGGAGTTATCTGCTCAGAA
TTCATGTCTCTGAGACTGACCAGTGAAGCCAGCAGAGAGGCCTGTGCAGGGCGTCTGGAA
GTTTTTTACAATGGAGCTTGGGGCACTGTTGGCAAGAGTAGCATGTCTGAAACCACTGTG
GGTGTGGTGTGCAGGCAGCTGGGCTGTGCAGACAAAGGGAAAATCAACCCTGCATCTTTA
GACAAGGCCATGTCCATTCCCATGTGGGTGGACAATGTTCAGTGTCCAAAAGGACCTGAC
ACGCTGTGGCAGTGCCCATCATCTCCATGGGAGAAGAGACTGGCCAGCCCCTCGGAGGAG
ACCTGGATCACATGTGACAACAAGATAAGACTTCAGGAAGGACCCACTTCCTGTTCTGGA
CGTGTGGAGATCTGGCATGGAGGTTCCTGGGGGACAGTGTGTGATGACTCTTGGGACTTG
GACGATGCTCAGGTGGTGTGTCAACAACTTGGCTGTGGTCCAGCTTTGAAAGCATTCAAA
GAAGCAGAGTTTGGTCAGGGGACTGGACCGATATGGCTCAATGAAGTGAAGTGCAAAGGG
AATGAGTCTTCCTTGTGGGATTGTCCTGCCAGACGCTGGGGCCATAGTGAGTGTGGGCAC
AAGGAAGACGCTGCAGTGAATTGCACAGATATTTCAGTGCAGAAAACCCCACAAAAAGCC
ACAACAGGTCGCTCATCCCGTCAGTCATCCTTTATTGCAGTCGGGATCCTTGGGGTTGTT
CTGTTGGCCATTTTCGTCGCATTATTCTTCTTGACTAAAAAGCGAAGACAGAGACAGCGG
CTTGCAGTTTCCTCAAGAGGAGAGAACTTAGTCCACCAAATTCAATACCGGGAGATGAAT
TCTTGCCTGAATGCAGATGATCTGGACCTAATGAATTCCTCAGAAAATTCCCATGAGTCA
GCTGATTTCAGTGCTGCTGAACTAATTTCTGTGTCTAAATTTCTTCCTATTTCTGGAATG
GAAAAGGAGGCCATTCTGAGCCACACTGAAAAGGAAAATGGGAATTTATAA
Protein Properties
Number of Residues 1156
Molecular Weight 125435.7
Theoretical pI 5.84
Pfam Domain Function
Signals
  • 1-41
Transmembrane Regions
  • 1051-1071
Protein Sequence
>Scavenger receptor cysteine-rich type 1 protein M130
MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRW
GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDA
AVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMG
DCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
DDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGH
KEDAAVNCTDISVQKTPQKATTGRSSRQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQR
LAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGM
EKEAILSHTEKENGNL
GenBank ID Protein 30410880
UniProtKB/Swiss-Prot ID Q86VB7
UniProtKB/Swiss-Prot Entry Name C163A_HUMAN
PDB IDs Not Available
GenBank Gene ID BC051281
GeneCard ID CD163
GenAtlas ID CD163
HGNC ID HGNC:1631
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Ritter M, Buechler C, Kapinsky M, Schmitz G: Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C. Eur J Immunol. 2001 Apr;31(4):999-1009. [PubMed:11298324 ]
  5. Law SK, Micklem KJ, Shaw JM, Zhang XP, Dong Y, Willis AC, Mason DY: A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily. Eur J Immunol. 1993 Sep;23(9):2320-5. [PubMed:8370408 ]
  6. Ritter M, Buechler C, Langmann T, Schmitz G: Genomic organization and chromosomal localization of the human CD163 (M130) gene: a member of the scavenger receptor cysteine-rich superfamily. Biochem Biophys Res Commun. 1999 Jul 5;260(2):466-74. [PubMed:10403791 ]
  7. Droste A, Sorg C, Hogger P: Shedding of CD163, a novel regulatory mechanism for a member of the scavenger receptor cysteine-rich family. Biochem Biophys Res Commun. 1999 Mar 5;256(1):110-3. [PubMed:10066432 ]
  8. Van den Heuvel MM, Tensen CP, van As JH, Van den Berg TK, Fluitsma DM, Dijkstra CD, Dopp EA, Droste A, Van Gaalen FA, Sorg C, Hogger P, Beelen RH: Regulation of CD 163 on human macrophages: cross-linking of CD163 induces signaling and activation. J Leukoc Biol. 1999 Nov;66(5):858-66. [PubMed:10577520 ]
  9. Buechler C, Ritter M, Orso E, Langmann T, Klucken J, Schmitz G: Regulation of scavenger receptor CD163 expression in human monocytes and macrophages by pro- and antiinflammatory stimuli. J Leukoc Biol. 2000 Jan;67(1):97-103. [PubMed:10648003 ]
  10. Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK: Identification of the haemoglobin scavenger receptor. Nature. 2001 Jan 11;409(6817):198-201. [PubMed:11196644 ]
  11. Matsushita N, Kashiwagi M, Wait R, Nagayoshi R, Nakamura M, Matsuda T, Hogger P, Guyre PM, Nagase H, Matsuyama T: Elevated levels of soluble CD163 in sera and fluids from rheumatoid arthritis patients and inhibition of the shedding of CD163 by TIMP-3. Clin Exp Immunol. 2002 Oct;130(1):156-61. [PubMed:12296867 ]
  12. Frings W, Dreier J, Sorg C: Only the soluble form of the scavenger receptor CD163 acts inhibitory on phorbol ester-activated T-lymphocytes, whereas membrane-bound protein has no effect. FEBS Lett. 2002 Aug 28;526(1-3):93-6. [PubMed:12208511 ]
  13. Hintz KA, Rassias AJ, Wardwell K, Moss ML, Morganelli PM, Pioli PA, Givan AL, Wallace PK, Yeager MP, Guyre PM: Endotoxin induces rapid metalloproteinase-mediated shedding followed by up-regulation of the monocyte hemoglobin scavenger receptor CD163. J Leukoc Biol. 2002 Oct;72(4):711-7. [PubMed:12377940 ]
  14. Moestrup SK, Moller HJ: CD163: a regulated hemoglobin scavenger receptor with a role in the anti-inflammatory response. Ann Med. 2004;36(5):347-54. [PubMed:15478309 ]
  15. Madsen M, Moller HJ, Nielsen MJ, Jacobsen C, Graversen JH, van den Berg T, Moestrup SK: Molecular characterization of the haptoglobin.hemoglobin receptor CD163. Ligand binding properties of the scavenger receptor cysteine-rich domain region. J Biol Chem. 2004 Dec 3;279(49):51561-7. Epub 2004 Sep 24. [PubMed:15448162 ]
  16. Sulahian TH, Pioli PA, Wardwell K, Guyre PM: Cross-linking of FcgammaR triggers shedding of the hemoglobin-haptoglobin scavenger receptor CD163. J Leukoc Biol. 2004 Jul;76(1):271-7. Epub 2004 Apr 9. [PubMed:15075364 ]
  17. Nielsen MJ, Madsen M, Moller HJ, Moestrup SK: The macrophage scavenger receptor CD163: endocytic properties of cytoplasmic tail variants. J Leukoc Biol. 2006 Apr;79(4):837-45. Epub 2006 Jan 24. [PubMed:16434690 ]