Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07486
Secondary Accession Numbers
  • 13194
Name Voltage-dependent calcium channel subunit alpha-2/delta-3
Synonyms
  1. Voltage-dependent calcium channel subunit alpha-2-3
  2. Voltage-dependent calcium channel subunit delta-3
  3. Voltage-gated calcium channel subunit alpha-2/delta-3
Gene Name CACNA2D3
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.1
SNPs CACNA2D3
Gene Sequence
>3276 bp
ATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCC
GCGCTTCTCTACGCCGCGCTGGGGGACGTGGTGCGCTCGGAGCAGCAGATACCGCTCTCC
GTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTAC
TCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAA
GAAATCGATGGCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCAC
AAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACAT
GAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGAC
AAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTT
AATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAAC
AAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTA
GATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTT
TTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGAC
TGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTA
GTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCA
TCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAG
CTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAA
GAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATA
GCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATC
TGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTT
GCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAG
GCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAG
ATCTCCACCTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGG
CCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACT
CTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCC
ATGCCTGTGTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTT
GGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATT
CACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGG
CTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCT
GAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACG
GGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATG
ACAAATGACTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTT
TCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCAT
GACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTA
CACCCTGAGCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAA
GAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTG
AGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGAC
AAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTT
GTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATT
TTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGC
TTCGTCTACTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCA
AGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATT
CAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCC
CTGGATGGCAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGAC
AATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAG
ATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTT
TATGACTACCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTC
CTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTG
TTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAG
AAATTGAAACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGC
ACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATC
CAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAA
TCTGTGGCCCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGT
GAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCT
GAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTT
CTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGGTGA
Protein Properties
Number of Residues 1091
Molecular Weight 123010.2
Theoretical pI 5.54
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • 1069-1089
Protein Sequence
>Voltage-dependent calcium channel subunit alpha-2/delta-3
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITL
YDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQ
KLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE
SVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAQTVLL
LLPLLLMLFSR
GenBank ID Protein 22770596
UniProtKB/Swiss-Prot ID Q8IZS8
UniProtKB/Swiss-Prot Entry Name CA2D3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF516696
GeneCard ID CACNA2D3
GenAtlas ID CACNA2D3
HGNC ID HGNC:15460
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Qin N, Yagel S, Momplaisir ML, Codd EE, D'Andrea MR: Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit. Mol Pharmacol. 2002 Sep;62(3):485-96. [PubMed:12181424 ]
  3. Gong HC, Hang J, Kohler W, Li L, Su TZ: Tissue-specific expression and gabapentin-binding properties of calcium channel alpha2delta subunit subtypes. J Membr Biol. 2001 Nov 1;184(1):35-43. [PubMed:11687876 ]
  4. Hanke S, Bugert P, Chudek J, Kovacs G: Cloning a calcium channel alpha2delta-3 subunit gene from a putative tumor suppressor gene region at chromosome 3p21.1 in conventional renal cell carcinoma. Gene. 2001 Feb 7;264(1):69-75. [PubMed:11245980 ]