You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07489
Secondary Accession Numbers
  • 13197
Name Calcineurin-binding protein cabin-1
Synonyms
  1. CAIN
  2. Calcineurin inhibitor
Gene Name CABIN1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function May be required for replication-independent chromatin assembly. May serve as a negative regulator of T-cell receptor (TCR) signaling via inhibition of calcineurin. Inhibition of activated calcineurin is dependent on both PKC and calcium signals
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:2
Locus 22q11.23
SNPs CABIN1
Gene Sequence
>6663 bp
ATGATTCGAATTGCAGCCTTAAATGCCAGCTCCACCATTGAGGATGATCATGAAGGAAGC
TTTAAAAGTCACAAAACCCAGACAAAGGAGGCTCAGGAAGCAGAGGCTTTTGCATTGTAC
CACAAGGCCCTTGATCTGCAGAAACATGACCGGTTTGAGGAGTCTGCCAAAGCCTACCAT
GAGCTCTTGGAGGCGAGCCTGCTGCGGGAGGCAGTTTCATCCGGTGATGAGAAAGAGGGG
TTGAAACACCCTGGGCTGATACTGAAATATTCCACTTATAAGAACTTGGCCCAGCTGGCA
GCCCAGCGGGAGGATCTGGAGACAGCCATGGAGTTCTACTTAGAGGCAGTGATGCTGGAC
TCCACAGATGTCAACCTCTGGTATAAGATTGGACATGTGGCCCTGAGGCTCATCCGGATC
CCCCTGGCTCGCCATGCTTTTGAGGAAGGGCTGCGGTGCAATCCTGACCACTGGCCCTGT
TTGGATAACCTAATCACTGTCCTGTACACCCTCAGTGATTACACAACATGTCTGTACTTC
ATCTGCAAAGCTTTGGAGAAGGATTGCCGGTACAGCAAAGGGCTGGTCCTCAAGGAGAAG
ATTTTTGAGGAGCAGCCTTGTCTCCGGAAGGACTCTCTCAGAATGTTCCTCAAATGTGAC
ATGTCGATTCACGATGTTTCGGTGAGTGCAGCTGAGACACAGGCGATTGTAGATGAGGCC
TTGGGGCTGCGAAAAAAGAGGCAAGCGCTGATTGTGCGGGAGAAGGAGCCGGACCTGAAA
CTTGTGCAGCCCATTCCTTTCTTCACCTGGAAGTGCCTCGGAGAGAGCTTGCTGGCCATG
TACAATCATCTCACCACCTGTGAGCCCCCACGTCCCAGCCTTGGCAAAAGGATTGATTTG
TCGGACTACCAGGACCCCAGCCAGCCTCTTGAGTCCTCCATGGTGGTGACGCCAGTTAAC
GTGATCCAGCCAAGCACTGTCAGCACCAACCCAGCTGTGGCTGTCGCCGAGCCTGTGGTC
TCCTACACCTCTGTGGCTACAACCAGCTTCCCACTGCACAGTCCTGGTCTGTTGGAGACA
GGCGCTCCTGTGGGTGATATTTCTGGGGGAGATAAATCCAAGAAAGGGGTAAAACGGAAG
AAGATTTCAGAAGAGAGTGGAGAAACAGCAAAGCGGCGGTCTGCCCGTGTCCGAAACACC
AAGTGCAAAAAAGAAGAGAAAGTAGACTTCCAGGAGCTTCTGATGAAGTTCTTGCCGTCC
AGGTTAAGAAAGCTGGACCCTGAGGAGGAAGATGATTCCTTTAATAACTATGAAGTCCAG
TCAGAAGCCAAACTGGAAAGCTTCCCAAGCATTGGGCCTCAAAGGCTGTCATTTGACTCA
GCCACATTCATGGAATCTGAAAAGCAGGACGTGCATGAGTTCCTGCTGGAGAACCTAACC
AACGGGGGCATCCTGGAGCTGATGATGCGCTACCTGAAAGCCATGGGCCACAAGTTCTTG
GTAAGGTGGCCTCCAGGCTTGGCGGAGGTCGTGCTCAGCGTCTACCACAGCTGGAGGAGG
CACAGCACCAGCCTGCCCAACCCGCTGCTGAGGGACTGCAGCAACAAGCACATCAAGGAC
ATGATGCTGATGTCTCTCTCCTGCATGGAACTCCAGCTGGACCAGTGGCTGCTGACCAAA
GGCAGAAGCTCTGCAGTGTCTCCTCGGAACTGTCCTGCTGGTATGGTGAATGGCAGATTT
GGACCTGACTTCCCAGGGACCCACTGCCTGGGTGACCTCCTACAGCTGTCATTTGCCTCG
TCCCAGCGCGACCTGTTCGAGGATGGTTGGCTGGAGTTTGTGGTCCGTGTTTACTGGCTG
AAGGCTCGCTTCCTGGCGCTGCAGGGAGACATGGAGCAGGCCCTGGAGAACTATGACATC
TGCACAGAAATGCTCCAGAGTTCCACCGCCATCCAGGTGGAGGCAGGGGCTGAACGAAGA
GACATTGTCATCCGGCTGCCCAACCTCCATAATGACTCTGTGGTTTCCCTGGAGGAGATT
GATAAGAACCTGAAGTCGCTGGAGCGGTGCCAGTCCCTGGAGGAGATTCAGCGGCTGTAT
GAAGCAGGCGACTACAAGGCTGTTGTGCATCTGCTCCGCCCCACTTTGTGCACCAGTGGG
TTTGACCGGGCCAAACACCTGGAGTTTATGACTTCCATTCCTGAGAGGCCAGCCCAGCTG
CTTCTTCTGCAGGACTCCTTGCTCCGGCTGAAGGACTATCGGCAGTGTTTTGAGTGTTCC
GATGTGGCTCTGAACGAGGCTGTCCAGCAGATGGTGAACTCAGGTGAGGCTGCCGCCAAG
GAGGAGTGGGTGGCCACAGTGACCCAACTGCTGATGGGCATCGAGCAGGCCCTCTCTGCG
GACAGCAGTGGTAGCATCCTGAAGGTATCATCCTCCACCACTGGCCTTGTGCGGCTCACC
AACAACCTCATCCAGGTCATTGACTGCAGCATGGCTGTGCAGGAGGAGGCCAAGGAGCCC
CACGTCTCTTCAGTGCTACCCTGGATCATTCTACACCGGATCATCTGGCAGGAGGAAGAC
ACCTTCCATTCTCTGTGCCACCAGCAGCAGCTCCAAAACCCAGCGGAGGAAGGGATGTCA
GAGACGCCCATGCTCCCATCCTCCCTCATGCTGCTGAACACAGCCCACGAGTATTTGGGC
AGAAGGTCCTGGTGCTGCAATTCAGATGGGGCTCTGCTGCGATTCTATGTGCGAGTACTC
CAGAAGGAACTGGCTGCATCCACCTCTGAAGACACGCACCCTTACAAGGAGGAGCTGGAG
ACAGCCTTGGAGCAGTGCTTCTACTGCCTGTACAGCTTCCCCAGCAAGAAGAGTAAGGCC
AGGTACCTGGAGGAACACTCGGCCCAGCAGGTGGATCTTATATGGGAGGATGCACTGTTC
ATGTTTGAGTATTTTAAGCCCAAGACCCTTCCTGAATTTGACAGCTATAAGACCAGCACC
GTGTCTGCTGACTTGGCCAACCTACTGAAGAGAATTGCCACCATTGTGCCTCGCACAGAG
AGGCCAGCCCTTAGCCTGGACAAAGTCTCTGCCTACATTGAGGGAACTTCAACTGAGGTA
CCCTGCCTCCCAGAGGGGGCTGACCCCTCCCCTCCAGTGGTGAACGAGCTTTACTACCTC
CTGGCTGATTATCATTTCAAAAACAAGGAGCAGTCCAAGGCCATCAAGTTCTACATGCAT
GACATCTGCATCTGCCCCAATAGGTTTGATTCCTGGGCAGGCATGGCTCTGGCCCGGGCC
AGCCGCATTCAGGACAAGCTGAACTCCAATGAGCTGAAGAGTGATGGGCCCATTTGGAAG
CATGCCACGCCCGTCTTGAACTGCTTCCGTCGGGCCCTGGAGATTGACAGCTCCAACTTG
TCCCTATGGATTGAGTATGGCACCATGTCCTATGCCTTGCACTCATTCGCCTCACGTCAA
TTGAAGCAGTGGAGAGGCGAGCTGCCCCCTGAGCTCGTGCAGCAGATGGAGGGCCGGCGC
GACAGCATGCTAGAGACAGCCAAGCACTGTTTCACATCAGCAGCCCGCTGCGAGGGTGAT
GGTGACGAGGAGGAGTGGCTCATCCACTACATGCTGGGCAAGGTGGCTGAGAAGCAGCAG
CAGCCACCCACCGTTTACTTGCTGCACTACAGGCAGGCTGGCCACTACCTGCACGAGGAG
GCTGCCCGCTACCCCAAGAAGATCCACTACCACAACCCACCTGAGCTGGCCATGGAGGCC
CTGGAGGTGTACTTTCGGCTCCATGCTTCCATCCTGAAGCTCCTGGGGAAGCCCGATTCT
GGGGTTGGTGCAGAGGTCCTGGTCAACTTTATGAAGGAGGCTGCAGAAGGACCCTTTGCC
AGGGGCGAGGAGAAGAACACACCCAAAGCTTCAGAAAAGGAGAAGGCCTGCCTGGTGGAC
GAGGACTCCCACTCTTCAGCTGGGACACTGCCGGGCCCCGGAGCCTCCCTCCCCTCCTCC
TCTGGCCCAGGTCTGACATCCCCACCTTACACAGCCACTCCGATTGACCACGATTACGTC
AAATGTAAAAAACCCCACCAGCAGGCAACGCCGGACGACCGAAGCCAGGACAGCACAGCC
GTAGCACTCTCAGACTCTAGCTCAACGCAGGACTTCTTTAATGAGCCCACCAGCTTACTG
GAAGGCTCCAGGAAATCCTACACAGAGAAGAGGCTGCCCATTCTCAGTTCCCAAGCAGGA
GCGACGGGTAAAGATCTTCAGGGGGCCACAGAAGAAAGAGGAAAAAACGAGGAGTCATTG
GAGAGTACAGAAGGCTTCCGGGCTGCAGAGCAAGGTGTCCAGAAGCCTGCTGCAGAAACC
CCAGCCTCTGCTTGCATCCCTGGCAAGCCCTCAGCATCCACACCCACCCTGTGGGATGGG
AAGAAGAGAGGGGACCTCCCAGGGGAGCCAGTGGCCTTCCCCCAGGGGCTGCCGGCTGGT
GCTGAGGAGCAGCGGCAGTTTCTCACAGAGCAGTGCATCGCCTCCTTCCGCCTGTGCCTG
AGCCGCTTCCCCCAGCACTATAAGAGTCTCTACCGTCTGGCCTTCCTCTACACCTACAGC
AAGACCCACCGGAACCTCCAGTGGGCCCGCGACGTGTTGCTAGGCAGCAGTATCCCGTGG
CAACAACTGCAGCACATGCCGGCACAGGGGCTCTTCTGCGAGAGGAACAAGACCAATTTC
TTCAACGGCATCTGGCGGATCCCCGTGGACGAGATTGACCGGCCGGGCAGCTTTGCCTGG
CACATGAACCGCTCCATCGTGCTGCTGCTCAAGGTGCTGGCCCAGCTGCGGGACCACAGC
ACCCTGCTGAAGGTGTCCTCCATGCTTCAGCGGACCCCAGACCAGGGCAAGAAGTATCTG
CGAGATGCTGACCGCCAGGTCCTGGCGCAGCGGGCCTTCATCCTCACTGTGAAGGTGCTC
GAAGACACGCTGAGCGAGCTCGCAGAGGGGTCAGAACGCCCAGGGCCCAAGGTCTGTGGC
CTCCCCGGAGCCAGGATGACCACCGATGTCTCACACAAGGCCAGTCCTGAGGATGGCCAG
GAGGGCCTCCCCCAGCCGAAGAAGCCCCCTCTGGCTGATGGCTCAGGGCCAGGGCCCGAG
CCAGGAGGCAAAGTGGGCCTCCTCAACCACCGGCCTGTGGCCATGGATGCAGGAGACAGT
GCAGACCAAAGCGGGGAGCGGAAGGATAAAGAGAGCCCACGGGCAGGGCCCACTGAGCCC
ATGGACACGAGTGAGGCCACTGTTTGCCACTCAGACTTGGAGCGGACACCACCCCTGCTG
CCAGGTCGCCCCGCAAGGGACCGGGGCCCCGAGAGCCGGCCCACTGAGCTGTCCCTGGAG
GAGCTGAGCATCAGTGCCCGGCAGCAGCCCACCCCGCTCACCCCAGCCCAGCCAGCCCCC
GCCCCCGCCCCCGCCACCACCACAGGGACCAGGGCAGGGGGCCACCCGGAGGAGCCGCTC
TCCCGGCTCAGCCGCAAGAGGAAGCTCCTGGAGGACACAGAGTCAGGCAAGACACTTCTG
TTGGATGCCTACCGTGTGTGGCAGCAGGGCCAGAAGGGTGTGGCCTATGACCTGGGCCGT
GTGGAGAGGATCATGTCGGAGACCTACATGCTCATCAAGCAGGTGGATGAGGAGGCTGCG
CTGGAGCAGGCTGTGAAGTTCTGCCAGGTCCATCTTGGGGCTGCCGCCCAGAGACAGGCC
TCGGGGGACACCCCCACCACTCCAAAGCACCCCAAAGACAGCCGAGAGAACTTCTTTCCT
GTGACAGTGGTGCCCACAGCCCCTGACCCTGTGCCAGCTGACTCTGTCCAGCGGCCCAGT
GATGCTCACACCAAGCCTCGCCCTGCACTAGCTGCCGCCACAACTATTATCACCTGCCCT
CCGTCAGCATCAGCTTCCACCCTGGACCAGTCCAAGGACCCTGGGCCTCCCCGGCCACAC
AGGCCTGAAGCTACCCCCAGCATGGCCTCTCTGGGCCCAGAGGGAGAAGAGCTGGCGAGA
GTGGCAGAGGGCACCAGCTTCCCGCCTCAGGAGCCACGGCACAGTCCGCAGGTGAAGATG
GCCCCCACAAGTTCCCCGGCAGAGCCACACTGCTGGCCGGCAGAGGCTGCCCTGGGCACA
GGCGCTGAGCCCACCTGCAGCCAGGAGGGGAAACTGAGGCCTGAGCCGAGAAGGGATGGG
GAGGCTCAGGAGGCTGCGAGTGAGACTCAGCCCCTGAGCTCTCCCCCAACAGCTGCCAGC
TCCAAGGCCCCCAGCAGTGGGAGTGCCCAGCCACCAGAGGGTCACCCAGGCAAGCCTGAG
CCCAGCCGGGCTAAGTCCCGCCCCCTGCCCAACATGCCAAAGCTGGTCATCCCCTCCGCC
GCCACCAAGTTCCCCCCTGAGATCACCGTCACGCCACCCACCCCAACCCTGCTCTCCCCC
AAAGGCAGCATCTCGGAGGAGACCAAGCAGAAGCTGAAGTCAGCCATCCTTTCTGCCCAG
TCTGCTGCCAACGTGAGGAAGGAGAGCCTATGCCAGCCAGCCCTGGAGGTCCTGGAGACA
TCCAGCCAGGAGTCCTCGCTGGAGAGCGAGACAGACGAGGACGACGACTACATGGACATT
TGA
Protein Properties
Number of Residues 2220
Molecular Weight 246349.5
Theoretical pI 5.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calcineurin-binding protein cabin-1
MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
VALSDSSSTQDFFNEPTSLLEGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESL
ESTEGFRAAEQGVQKPAAETPASACIPGKPSASTPTLWDGKKRGDLPGEPVAFPQGLPAG
AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
ADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
ELSISARQQPTPLTPAQPAPAPAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLL
LDAYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQA
SGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPSDAHTKPRPALAAATTIITCP
PSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKM
APTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS
SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSP
KGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI
GenBank ID Protein 6912458
UniProtKB/Swiss-Prot ID Q9Y6J0
UniProtKB/Swiss-Prot Entry Name CABIN_HUMAN
PDB IDs
GenBank Gene ID NM_012295.2
GeneCard ID CABIN1
GenAtlas ID CABIN1
HGNC ID HGNC:24187
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  2. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  3. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  4. Sun L, Youn HD, Loh C, Stolow M, He W, Liu JO: Cabin 1, a negative regulator for calcineurin signaling in T lymphocytes. Immunity. 1998 Jun;8(6):703-11. [PubMed:9655484 ]
  5. Tagami H, Ray-Gallet D, Almouzni G, Nakatani Y: Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis. Cell. 2004 Jan 9;116(1):51-61. [PubMed:14718166 ]
  6. Han A, Pan F, Stroud JC, Youn HD, Liu JO, Chen L: Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2. Nature. 2003 Apr 17;422(6933):730-4. [PubMed:12700764 ]