Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07491
Secondary Accession Numbers
  • 13199
Name Voltage-dependent P/Q-type calcium channel subunit alpha-1A
Synonyms
  1. BI
  2. Brain calcium channel I
  3. Calcium channel, L type, alpha-1 polypeptide isoform 4
  4. Voltage-gated calcium channel subunit alpha Cav2.1
Gene Name CACNA1A
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1A gives rise to P and/or Q-type calcium currents. P/Q-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by the funnel toxin (Ftx) and by the omega-agatoxin- IVA (omega-Aga-IVA). They are however insensitive to dihydropyridines (DHP), and omega-conotoxin-GVIA (omega-CTx-GVIA)
Pathways
  • 3-Methylthiofentanyl Action Pathway
  • Alfentanil Action Pathway
  • Alvimopan Action Pathway
  • Anileridine Action Pathway
  • Benzocaine Action Pathway
  • Bupivacaine Action Pathway
  • Buprenorphine Action Pathway
  • Carfentanil Action Pathway
  • Chloroprocaine Action Pathway
  • Citalopram Action Pathway
  • Cocaine Action Pathway
  • Codeine Action Pathway
  • Desipramine Action Pathway
  • Dezocine Action Pathway
  • Dibucaine Action Pathway
  • Dihydromorphine Action Pathway
  • Dimethylthiambutene Action Pathway
  • Diphenoxylate Action Pathway
  • Escitalopram Action Pathway
  • Ethylmorphine Action Pathway
  • Fentanyl Action Pathway
  • Fluoxetine Action Pathway
  • Glibenclamide Action Pathway
  • Gliclazide Action Pathway
  • Heroin Action Pathway
  • Hydrocodone Action Pathway
  • Hydromorphone Action Pathway
  • Imipramine Action Pathway
  • Ketobemidone Action Pathway
  • Levallorphan Action Pathway
  • Levobupivacaine Action Pathway
  • Levomethadyl Acetate Action Action Pathway
  • Levorphanol Action Pathway
  • Lidocaine (Local Anaesthetic) Action Pathway
  • Mepivacaine Action Pathway
  • Methadone Action Pathway
  • Methadyl Acetate Action Pathway
  • Morphine Action Pathway
  • Nalbuphine Action Pathway
  • Naloxone Action Pathway
  • Naltrexone Action Pathway
  • Nateglinide Action Pathway
  • Nicotine Action Pathway
  • Oxybuprocaine Action Pathway
  • Oxycodone Action Pathway
  • Oxymorphone Action Pathway
  • Pancreas Function
  • Pentazocine Action Pathway
  • Prilocaine Action Pathway
  • Procaine Action Pathway
  • Proparacaine Action Pathway
  • Propoxyphene Action Pathway
  • Remifentanil Action Pathway
  • Repaglinide Action Pathway
  • Ropivacaine Action Pathway
  • Sufentanil Action Pathway
  • Tramadol Action Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
calcium channel complex
voltage-gated calcium channel complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13
SNPs CACNA1A
Gene Sequence
>7518 bp
ATGGCCCGCTTCGGAGACGAGATGCCGGCCCGCTACGGGGGAGGAGGCTCCGGGGCAGCC
GCCGGGGTGGTCGTGGGCAGCGGAGGCGGGCGAGGAGCCGGGGGCAGCCGGCAGGGCGGG
CAGCCCGGGGCGCAAAGGATGTACAAGCAGTCAATGGCGCAGAGAGCGCGGACCATGGCA
CTCTACAACCCCATCCCCGTCCGACAGAACTGCCTCACGGTTAACCGGTCTCTCTTCCTC
TTCAGCGAAGACAACGTGGTGAGAAAATACGCCAAAAAGATCACCGAATGGCCTCCCTTT
GAATATATGATTTTAGCCACCATCATAGCGAATTGCATCGTCCTCGCACTGGAGCAGCAT
CTGCCTGATGATGACAAGACCCCGATGTCTGAACGGCTGGATGACACAGAACCATACTTC
ATTGGAATTTTTTGTTTCGAGGCTGGAATTAAAATCATTGCCCTTGGGTTTGCCTTCCAC
AAAGGCTCCTACTTGAGGAATGGCTGGAATGTCATGGACTTTGTGGTGGTGCTAACGGGC
ATCTTGGCGACAGTTGGGACGGAGTTTGACCTACGGACGCTGAGGGCAGTTCGAGTGCTG
CGGCCGCTCAAGCTGGTGTCTGGAATCCCAAGTTTACAAGTCGTCCTGAAGTCGATCATG
AAGGCGATGATCCCTTTGCTGCAGATCGGCCTCCTCCTATTTTTTGCAATCCTTATTTTT
GCAATCATAGGGTTAGAATTTTATATGGGAAAATTTCATACCACCTGCTTTGAAGAGGGG
ACAGATGACATTCAGGGTGAGTCTCCGGCTCCATGTGGGACAGAAGAGCCCGCCCGCACC
TGCCCCAATGGGACCAAATGTCAGCCCTACTGGGAAGGGCCCAACAACGGGATCACTCAG
TTCGACAACATCCTGTTTGCAGTGCTGACTGTTTTCCAGTGCATAACCATGGAAGGGTGG
ACTGATCTCCTCTACAATAGCAACGATGCCTCAGGGAACACTTGGAACTGGTTGTACTTC
ATCCCCCTCATCATCATCGGCTCCTTTTTTATGCTGAACCTTGTGCTGGGTGTGCTGTCA
GGGGAGTTTGCCAAAGAAAGGGAACGGGTGGAGAACCGGCGGGCTTTTCTGAAGCTGAGG
CGGCAACAACAGATTGAACGTGAGCTCAATGGGTACATGGAATGGATCTCAAAAGCAGAA
GAGGTGATCCTCGCCGAGGATGAAACTGACGGGGAGCAGAGGCATCCCTTTGATGGAGCT
CTGCGGAGAACCACCATAAAGAAAAGCAAGACAGATTTGCTCAACCCCGAAGAGGCTGAG
GATCAGCTGGCTGATATAGCCTCTGTGGGTTCTCCCTTCGCCCGAGCCAGCATTAAAAGT
GCCAAGCTGGAGAACTCGACCTTTTTTCACAAAAAGGAGAGGAGGATGCGTTTCTACATC
CGCCGCATGGTCAAAACTCAGGCCTTCTACTGGACTGTACTCAGTTTGGTAGCTCTCAAC
ACGCTGTGTGTTGCTATTGTTCACTACAACCAGCCCGAGTGGCTCTCCGACTTCCTTTAC
TATGCAGAATTCATTTTCTTAGGACTCTTTATGTCCGAAATGTTTATAAAAATGTACGGG
CTTGGGACGCGGCCTTACTTCCACTCTTCCTTCAACTGCTTTGACTGTGGGGTTATCATT
GGGAGCATCTTCGAGGTCATCTGGGCTGTCATAAAACCTGGCACATCCTTTGGAATCAGC
GTGTTACGAGCCCTCAGGTTATTGCGTATTTTCAAAGTCACAAAGTACTGGGCATCTCTC
AGAAACCTGGTCGTCTCTCTCCTCAACTCCATGAAGTCCATCATCAGCCTGTTGTTTCTC
CTTTTCCTGTTCATTGTCGTCTTCGCCCTTTTGGGAATGCAACTCTTCGGCGGCCAGTTT
AATTTCGATGAAGGGACTCCTCCCACCAACTTCGATACTTTTCCAGCAGCAATAATGACG
GTGTTTCAGATCCTGACGGGCGAAGACTGGAACGAGGTCATGTACGACGGGATCAAGTCT
CAGGGGGGCGTGCAGGGCGGCATGGTGTTCTCCATCTATTTCATTGTACTGACGCTCTTT
GGGAACTACACCCTCCTGAATGTGTTCTTGGCCATCGCTGTGGACAATCTGGCCAACGCC
CAGGAGCTCACCAAGGACGAGCAAGAGGAAGAAGAAGCAGCGAACCAGAAACTTGCCCTA
CAGAAAGCCAAGGAGGTGGCAGAAGTGAGTCCTCTGTCCGCGGCCAACATGTCTATAGCT
GTGAAAGAGCAACAGAAGAATCAAAAGCCAGCCAAGTCCGTGTGGGAGCAGCGGACCAGT
GAGATGCGAAAGCAGAACTTGCTGGCCAGCCGGGAGGCCCTGTATAACGAAATGGACCCG
GACGAGCGCTGGAAGGCTGCCTACACGCGGCACCTGCGGCCAGACATGAAGACGCACTTG
GACCGGCCGCTGGTGGTGGACCCGCAGGAGAACCGCAACAACAACACCAACAAGAGCCGG
GCGGCCGAGCCCACCGTGGACCAGCGCCTCGGCCAGCAGCGCGCCGAGGACTTCCTCAGG
AAACAGGCCCGCTACCACGATCGGGCCCGGGACCCCAGCGGCTCGGCGGGCCTGGACGCA
CGGAGGCCCTGGGCGGGAAGCCAGGAGGCCGAGCTGAGCCGGGAGGGACCCTACGGCCGC
GAGTCGGACCACCACGCCCGGGAGGGCAGCCTGGAGCAACCCGGGTTCTGGGAGGGCGAG
GCCGAGCGAGGCAAGGCCGGGGACCCCCACCGGAGGCACGTGCACCGGCAGGGGGGCAGC
AGGGAGAGCCGCAGCGGGTCCCCGCGCACGGGCGCGGACGGGGAGCATCGACGTCATCGC
GCGCACCGCAGGCCCGGGGAGGAGGGTCCGGAGGACAAGGCGGAGCGGAGGGCGCGGCAC
CGCGAGGGCAGCCGGCCGGCCCGGGGCGGCGAGGGCGAGGGCGAGGGCCCCGACGGGGGC
GAGCGCAGGAGAAGGCACCGGCATGGCGCTCCAGCCACGTACGAGGGGGACGCGCGGAGG
GAGGACAAGGAGCGGAGGCATCGGAGGAGGAAAGAGAACCAGGGCTCCGGGGTCCCTGTG
TCGGGCCCCAACCTGTCAACCACCCGGCCAATCCAGCAGGACCTGGGCCGCCAAGACCCA
CCCCTGGCAGAGGATATTGACAACATGAAGAACAACAAGCTGGCCACCGCGGAGTCGGCC
GCTCCCCACGGCAGCCTTGGCCACGCCGGCCTGCCCCAGAGCCCAGCCAAGATGGGAAAC
AGCACCGACCCCGGCCCCATGCTGGCCATCCCTGCCATGGCCACCAACCCCCAGAACGCC
GCCAGCCGCCGGACGCCCAACAACCCGGGGAACCCATCCAATCCCGGCCCCCCCAAGACC
CCCGAGAATAGCCTTATCGTCACCAACCCCAGCGGCACCCAGACCAATTCAGCTAAGACT
GCCAGGAAACCCGACCACACCACAGTGGACATCCCCCCAGCCTGCCCACCCCCCCTCAAC
CACACCGTCGTACAAGTGAACAAAAACGCCAACCCAGACCCACTGCCAAAAAAAGAGGAA
GAGAAGAAGGAGGAGGAGGAAGACGACCGTGGGGAAGACGGCCCTAAGCCAATGCCTCCC
TATAGCTCCATGTTCATCCTGTCCACGACCAACCCCCTTCGCCGCCTGTGCCATTACATC
CTGAACCTGCGCTACTTTGAGATGTGCATCCTCATGGTCATTGCCATGAGCAGCATCGCC
CTGGCCGCCGAGGACCCTGTGCAGCCCAACGCACCTCGGAACAACGTGCTGCGATACTTT
GACTACGTTTTTACAGGCGTCTTTACCTTTGAGATGGTGATCAAGATGATTGACCTGGGG
CTCGTCCTGCATCAGGGTGCCTACTTCCGTGACCTCTGGAATATTCTCGACTTCATAGTG
GTCAGTGGGGCCCTGGTAGCCTTTGCCTTCACTGGCAATAGCAAAGGAAAAGACATCAAC
ACGATTAAATCCCTCCGAGTCCTCCGGGTGCTACGACCTCTTAAAACCATCAAGCGGCTG
CCAAAGCTCAAGGCTGTGTTTGACTGTGTGGTGAACTCACTTAAAAACGTCTTCAACATC
CTCATCGTCTACATGCTATTCATGTTCATCTTCGCCGTGGTGGCTGTGCAGCTCTTCAAG
GGGAAATTCTTCCACTGCACTGACGAGTCCAAAGAGTTTGAGAAAGATTGTCGAGGCAAA
TACCTCCTCTACGAGAAGAATGAGGTGAAGGCGCGAGACCGGGAGTGGAAGAAGTATGAA
TTCCATTACGACAATGTGCTGTGGGCTCTGCTGACCCTCTTCACCGTGTCCACGGGAGAA
GGCTGGCCACAGGTCCTCAAGCATTCGGTGGACGCCACCTTTGAGAACCAGGGCCCCAGC
CCCGGGTACCGCATGGAGATGTCCATTTTCTACGTCGTCTACTTTGTGGTGTTCCCCTTC
TTCTTTGTCAATATCTTTGTGGCCTTGATCATCATCACCTTCCAGGAGCAAGGGGACAAG
ATGATGGAGGAATACAGCCTGGAGAAAAATGAGAGGGCCTGCATTGATTTCGCCATCAGC
GCCAAGCCGCTGACCCGACACATGCCGCAGAACAAGCAGAGCTTCCAGTACCGCATGTGG
CAGTTCGTGGTGTCTCCGCCTTTCGAGTACACGATCATGGCCATGATCGCCCTCAACACC
ATCGTGCTTATGATGAAGTTCTATGGGGCTTCTGTTGCTTATGAAAATGCCCTGCGGGTG
TTCAACATCGTCTTCACCTCCCTCTTCTCTCTGGAATGTGTGCTGAAAGTCATGGCTTTT
GGGATTCTGAATTATTTCCGCGATGCCTGGAACATCTTCGACTTTGTGACTGTTCTGGGC
AGCATCACCGATATCCTCGTGACTGAGTTTGGGAATAACTTCATCAACCTGAGCTTTCTC
CGCCTCTTCCGAGCTGCCCGGCTCATCAAACTTCTCCGTCAGGGTTACACCATCCGCATT
CTTCTCTGGACCTTTGTGCAGTCCTTCAAGGCCCTGCCTTATGTCTGTCTGCTGATCGCC
ATGCTCTTCTTCATCTATGCCATCATTGGGATGCAGGTGTTTGGTAACATTGGCATCGAC
GTGGAGGACGAGGACAGTGATGAAGATGAGTTCCAAATCACTGAGCACAATAACTTCCGG
ACCTTCTTCCAGGCCCTCATGCTTCTCTTCCGGAGTGCCACCGGGGAAGCTTGGCACAAC
ATCATGCTTTCCTGCCTCAGCGGGAAACCGTGTGATAAGAACTCTGGCATCCTGACTCGA
GAGTGTGGCAATGAATTTGCTTATTTTTACTTTGTTTCCTTCATCTTCCTCTGCTCGTTT
CTGATGCTGAATCTCTTTGTCGCCGTCATCATGGACAACTTTGAGTACCTCACCCGAGAC
TCCTCCATCCTGGGCCCCCACCACCTGGATGAGTACGTGCGTGTCTGGGCCGAGTATGAC
CCCGCAGCTTGCGGTCGGATTCATTATAAGGATATGTACAGTTTATTACGAGTAATATCT
CCCCCTCTCGGCTTAGGCAAGAAATGTCCTCATAGGGTTGCTTGCAAGCGGCTTCTGCGG
ATGGACCTGCCCGTCGCAGATGACAACACCGTCCACTTCAATTCCACCCTCATGGCTCTG
ATCCGCACAGCCCTGGACATCAAGATTGCCAAGGGAGGAGCCGACAAACAGCAGATGGAC
GCTGAGCTGCGGAAGGAGATGATGGCGATTTGGCCCAATCTGTCCCAGAAGACGCTAGAC
CTGCTGGTCACACCTCACAAGTCCACGGACCTCACCGTGGGGAAGATCTACGCAGCCATG
ATGATCATGGAGTACTACCGGCAGAGCAAGGCCAAGAAGCTGCAGGCCATGCGCGAGGAG
CAGGACCGGACACCCCTCATGTTCCAGCGCATGGAGCCCCCGTCCCCAACGCAGGAAGGG
GGACCTGGCCAGAACGCCCTCCCCTCCACCCAGCTGGACCCAGGAGGAGCCCTGATGGCT
CACGAAAGCGGCCTCAAGGAGAGCCCGTCCTGGGTGACCCAGCGTGCCCAGGAGATGTTC
CAGAAGACGGGCACATGGAGTCCGGAACAAGGCCCCCCTACCGACATGCCCAACAGCCAG
CCTAACTCTCAGTCCGTGGAGATGCGAGAGATGGGCAGAGATGGCTACTCCGACAGCGAG
CACTACCTCCCCATGGAAGGCCAGGGCCGGGCTGCCTCCATGCCCCGCCTCCCTGCAGAG
AACCAGAGGAGAAGGGGCCGGCCACGTGGGAATAACCTCAGTACCATCTCAGACACCAGC
CCCATGAAGCGTTCAGCCTCCGTGCTGGGCCCCAAGGCCCGACGCCTGGACGATTACTCG
CTGGAGCGGGTCCCGCCCGAGGAGAACCAGCGGCACCACCAGCGGCGCCGCGACCGCAGC
CACCGCGCCTCTGAGCGCTCCCTGGGCCGCTACACCGATGTGGACACAGGCTTGGGGACA
GACCTGAGCATGACCACCCAATCCGGGGACCTGCCGTCGAAGGAGCGGGACCAGGAGCGG
GGCCGGCCCAAGGATCGGAAGCATCGACAGCACCACCACCACCACCACCACCACCACCAT
CCCCCGCCCCCCGACAAGGACCGCTATGCCCAGGAACGGCCGGACCACGGCCGGGCACGG
GCTCGGGACCAGCGCTGGTCCCGCTCGCCCAGCGAGGGCCGAGAGCACATGGCGCACCGG
CAGGGCAGTAGTTCCGTAAGTGGAAGCCCAGCCCCCTCAACATCTGGTACCAGCACTCCG
CGGCGGGGCCGCCGCCAGCTCCCCCAGACCCCCTCCACCCCCCGGCCACACGTGTCCTAT
TCCCCTGTGATCCGTAAGGCCGGCGGCTCGGGGCCCCCGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGGCGGTGGCCAGGCCGGGCCGGGCGGCCACCAGCGGCCCTCGGAGGTAC
CCAGGCCCCACGGCCGAGCCTCTGGCCGGAGATCGGCCGCCCACGGGGGGCCACAGCAGC
GGCCGCTCGCCCAGGATGGAGAGGCGGGTCCCAGGCCCGGCCCGGAGCGAGTCCCCCAGG
GCCTGTCGACACGGCGGGGCCCGGTGGCCGGCATCTGGCCCGCACGTGTCCGAGGGGCCC
CCGGGTCCCCGGCACCATGGCTACTACCGGGGCTCCGACTACGACGAGGCCGATGGCCCG
GGCAGCGGGGGCGGCGAGGAGGCCATGGCCGGGGCCTACGACGCGCCACCCCCCGTACGA
CACGCGTCCTCGGGCGCCACCGGGCGCTCGCCCAGGACTCCCCGGGCCTCGGGCCCGGCC
TGCGCCTCGCCTTCTCGGCACGGCCGGCGACTCCCCAACGGCTACTACCCGGCGCACGGA
CTGGCCAGGCCCCGCGGGCCGGGCTCCAGGAAGGGCCTGCACGAACCCTACAGCGAGAGT
GACGATGATTGGTGCTAA
Protein Properties
Number of Residues 2505
Molecular Weight 282362.4
Theoretical pI 9.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 99-117
  • 136-155
  • 168-185
  • 191-209
  • 229-248
  • 336-360
  • 488-506
  • 522-541
  • 550-568
  • 579-597
  • 617-636
  • 690-714
  • 1243-1261
  • 1278-1297
  • 1310-1328
  • 1340-1358
  • 1378-1397
  • 1485-1509
  • 1565-1593
  • 1599-1618
  • 1627-1645
  • 1653-1671
  • 1691-1710
  • 1783-1807
Protein Sequence
>Voltage-dependent P/Q-type calcium channel subunit alpha-1A
MARFGDEMPARYGGGGSGAAAGVVVGSGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGA
LRRTTIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYI
RRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYG
LGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASL
RNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMT
VFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANA
QELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRTS
EMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSR
AAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGR
ESDHHAREGSLEQPGFWEGEAERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEHRRHR
AHRRPGEEGPEDKAERRARHREGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGDARR
EDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESA
APHGSLGHAGLPQSPAKMGNSTDPGPMLAIPAMATNPQNAASRRTPNNPGNPSNPGPPKT
PENSLIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEE
EKKEEEEDDRGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIA
LAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIV
VSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNI
LIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYE
FHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPF
FFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMW
QFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAF
GILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRI
LLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFR
TFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSF
LMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQMLRHMS
PPLGLGKKCPARVAYKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMD
AELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREE
QDRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQRAQEMF
QKTGTWSPEQGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAE
NQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRS
HRASERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHH
PPPPDKDRYAQERPDHGRARARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTP
RRGRRQLPQTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQQQQAVARPGRAATSGPRRY
PGPTAEPLAGDRPPTGGHSSGRSPRMERRVPGPARSESPRACRHGGARWPASGPHVSEGP
PGPRHHGYYRGSDYDEADGPGSGGGEEAMAGAYDAPPPVRHASSGATGRSPRTPRASGPA
CASPSRHGRRLPNGYYPAHGLARPRGPGSRKGLHEPYSESDDDWC
GenBank ID Protein 2281752
UniProtKB/Swiss-Prot ID O00555
UniProtKB/Swiss-Prot Entry Name CAC1A_HUMAN
PDB IDs Not Available
GenBank Gene ID U79666
GeneCard ID CACNA1A
GenAtlas ID CACNA1A
HGNC ID HGNC:1388
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Oguro-Okano M, Griesmann GE, Wieben ED, Slaymaker SJ, Snutch TP, Lennon VA: Molecular diversity of neuronal-type calcium channels identified in small cell lung carcinoma. Mayo Clin Proc. 1992 Dec;67(12):1150-9. [PubMed:1335101 ]
  3. Hans M, Urrutia A, Deal C, Brust PF, Stauderman K, Ellis SB, Harpold MM, Johnson EC, Williams ME: Structural elements in domain IV that influence biophysical and pharmacological properties of human alpha1A-containing high-voltage-activated calcium channels. Biophys J. 1999 Mar;76(3):1384-400. [PubMed:10049321 ]
  4. Ophoff RA, Terwindt GM, Vergouwe MN, van Eijk R, Oefner PJ, Hoffman SM, Lamerdin JE, Mohrenweiser HW, Bulman DE, Ferrari M, Haan J, Lindhout D, van Ommen GJ, Hofker MH, Ferrari MD, Frants RR: Familial hemiplegic migraine and episodic ataxia type-2 are caused by mutations in the Ca2+ channel gene CACNL1A4. Cell. 1996 Nov 1;87(3):543-52. [PubMed:8898206 ]
  5. Zhuchenko O, Bailey J, Bonnen P, Ashizawa T, Stockton DW, Amos C, Dobyns WB, Subramony SH, Zoghbi HY, Lee CC: Autosomal dominant cerebellar ataxia (SCA6) associated with small polyglutamine expansions in the alpha 1A-voltage-dependent calcium channel. Nat Genet. 1997 Jan;15(1):62-9. [PubMed:8988170 ]
  6. Barry EL, Viglione MP, Kim YI, Froehner SC: Expression and antibody inhibition of P-type calcium channels in human small-cell lung carcinoma cells. J Neurosci. 1995 Jan;15(1 Pt 1):274-83. [PubMed:7823133 ]
  7. Margolis RL, Breschel TS, Li SH, Kidwai AS, Antonarakis SE, McInnis MG, Ross CA: Characterization of cDNA clones containing CCA trinucleotide repeats derived from human brain. Somat Cell Mol Genet. 1995 Jul;21(4):279-84. [PubMed:8525433 ]
  8. Lee A, Westenbroek RE, Haeseleer F, Palczewski K, Scheuer T, Catterall WA: Differential modulation of Ca(v)2.1 channels by calmodulin and Ca2+-binding protein 1. Nat Neurosci. 2002 Mar;5(3):210-7. [PubMed:11865310 ]
  9. Mori MX, Vander Kooi CW, Leahy DJ, Yue DT: Crystal structure of the CaV2 IQ domain in complex with Ca2+/calmodulin: high-resolution mechanistic implications for channel regulation by Ca2+. Structure. 2008 Apr;16(4):607-20. doi: 10.1016/j.str.2008.01.011. [PubMed:18400181 ]
  10. Yue Q, Jen JC, Nelson SF, Baloh RW: Progressive ataxia due to a missense mutation in a calcium-channel gene. Am J Hum Genet. 1997 Nov;61(5):1078-87. [PubMed:9345107 ]
  11. Jodice C, Mantuano E, Veneziano L, Trettel F, Sabbadini G, Calandriello L, Francia A, Spadaro M, Pierelli F, Salvi F, Ophoff RA, Frants RR, Frontali M: Episodic ataxia type 2 (EA2) and spinocerebellar ataxia type 6 (SCA6) due to CAG repeat expansion in the CACNA1A gene on chromosome 19p. Hum Mol Genet. 1997 Oct;6(11):1973-8. [PubMed:9302278 ]
  12. Friend KL, Crimmins D, Phan TG, Sue CM, Colley A, Fung VS, Morris JG, Sutherland GR, Richards RI: Detection of a novel missense mutation and second recurrent mutation in the CACNA1A gene in individuals with EA-2 and FHM. Hum Genet. 1999 Sep;105(3):261-5. [PubMed:10987655 ]
  13. Carrera P, Piatti M, Stenirri S, Grimaldi LM, Marchioni E, Curcio M, Righetti PG, Ferrari M, Gelfi C: Genetic heterogeneity in Italian families with familial hemiplegic migraine. Neurology. 1999 Jul 13;53(1):26-33. [PubMed:10408532 ]
  14. Kors EE, Terwindt GM, Vermeulen FL, Fitzsimons RB, Jardine PE, Heywood P, Love S, van den Maagdenberg AM, Haan J, Frants RR, Ferrari MD: Delayed cerebral edema and fatal coma after minor head trauma: role of the CACNA1A calcium channel subunit gene and relationship with familial hemiplegic migraine. Ann Neurol. 2001 Jun;49(6):753-60. [PubMed:11409427 ]
  15. Denier C, Ducros A, Durr A, Eymard B, Chassande B, Tournier-Lasserve E: Missense CACNA1A mutation causing episodic ataxia type 2. Arch Neurol. 2001 Feb;58(2):292-5. [PubMed:11176968 ]
  16. Ducros A, Denier C, Joutel A, Cecillon M, Lescoat C, Vahedi K, Darcel F, Vicaut E, Bousser MG, Tournier-Lasserve E: The clinical spectrum of familial hemiplegic migraine associated with mutations in a neuronal calcium channel. N Engl J Med. 2001 Jul 5;345(1):17-24. [PubMed:11439943 ]
  17. Jen J, Wan J, Graves M, Yu H, Mock AF, Coulin CJ, Kim G, Yue Q, Papazian DM, Baloh RW: Loss-of-function EA2 mutations are associated with impaired neuromuscular transmission. Neurology. 2001 Nov 27;57(10):1843-8. [PubMed:11723274 ]
  18. van den Maagdenberg AM, Kors EE, Brunt ER, van Paesschen W, Pascual J, Ravine D, Keeling S, Vanmolkot KR, Vermeulen FL, Terwindt GM, Haan J, Frants RR, Ferrari MD: Episodic ataxia type 2. Three novel truncating mutations and one novel missense mutation in the CACNA1A gene. J Neurol. 2002 Nov;249(11):1515-9. [PubMed:12420090 ]
  19. Spacey SD, Hildebrand ME, Materek LA, Bird TD, Snutch TP: Functional implications of a novel EA2 mutation in the P/Q-type calcium channel. Ann Neurol. 2004 Aug;56(2):213-20. [PubMed:15293273 ]
  20. Alonso I, Barros J, Tuna A, Seixas A, Coutinho P, Sequeiros J, Silveira I: A novel R1347Q mutation in the predicted voltage sensor segment of the P/Q-type calcium-channel alpha-subunit in a family with progressive cerebellar ataxia and hemiplegic migraine. Clin Genet. 2004 Jan;65(1):70-2. [PubMed:15032980 ]
  21. Mantuano E, Veneziano L, Spadaro M, Giunti P, Guida S, Leggio MG, Verriello L, Wood N, Jodice C, Frontali M: Clusters of non-truncating mutations of P/Q type Ca2+ channel subunit Ca(v)2.1 causing episodic ataxia 2. J Med Genet. 2004 Jun;41(6):e82. [PubMed:15173248 ]
  22. Jen J, Kim GW, Baloh RW: Clinical spectrum of episodic ataxia type 2. Neurology. 2004 Jan 13;62(1):17-22. [PubMed:14718690 ]
  23. von Brevern M, Ta N, Shankar A, Wiste A, Siegel A, Radtke A, Sander T, Escayg A: Migrainous vertigo: mutation analysis of the candidate genes CACNA1A, ATP1A2, SCN1A, and CACNB4. Headache. 2006 Jul-Aug;46(7):1136-41. [PubMed:16866717 ]
  24. Tonelli A, D'Angelo MG, Salati R, Villa L, Germinasi C, Frattini T, Meola G, Turconi AC, Bresolin N, Bassi MT: Early onset, non fluctuating spinocerebellar ataxia and a novel missense mutation in CACNA1A gene. J Neurol Sci. 2006 Feb 15;241(1-2):13-7. Epub 2005 Dec 2. [PubMed:16325861 ]
  25. Stam AH, Vanmolkot KR, Kremer HP, Gartner J, Brown J, Leshinsky-Silver E, Gilad R, Kors EE, Frankhuizen WS, Ginjaar HB, Haan J, Frants RR, Ferrari MD, van den Maagdenberg AM, Terwindt GM: CACNA1A R1347Q: a frequent recurrent mutation in hemiplegic migraine. Clin Genet. 2008 Nov;74(5):481-5. doi: 10.1111/j.1399-0004.2008.00996.x. Epub 2008 Apr 8. [PubMed:18400034 ]
  26. Zafeiriou DI, Lehmann-Horn F, Vargiami E, Teflioudi E, Ververi A, Jurkat-Rott K: Episodic ataxia type 2 showing ictal hyperhidrosis with hypothermia and interictal chronic diarrhea due to a novel CACNA1A mutation. Eur J Paediatr Neurol. 2009 Mar;13(2):191-3. doi: 10.1016/j.ejpn.2008.02.011. Epub 2008 Jul 3. [PubMed:18602318 ]
  27. Cuenca-Leon E, Banchs I, Serra SA, Latorre P, Fernandez-Castillo N, Corominas R, Valverde MA, Volpini V, Fernandez-Fernandez JM, Macaya A, Cormand B: Late-onset episodic ataxia type 2 associated with a novel loss-of-function mutation in the CACNA1A gene. J Neurol Sci. 2009 May 15;280(1-2):10-4. doi: 10.1016/j.jns.2009.01.005. Epub 2009 Feb 20. [PubMed:19232643 ]
  28. D'Onofrio M, Ambrosini A, Di Mambro A, Arisi I, Santorelli FM, Grieco GS, Nicoletti F, Nappi G, Pierelli F, Schoenen J, Buzzi MG: The interplay of two single nucleotide polymorphisms in the CACNA1A gene may contribute to migraine susceptibility. Neurosci Lett. 2009 Mar 27;453(1):12-5. doi: 10.1016/j.neulet.2009.01.081. Epub 2009 Feb 4. [PubMed:19429006 ]
  29. Romaniello R, Zucca C, Tonelli A, Bonato S, Baschirotto C, Zanotta N, Epifanio R, Righini A, Bresolin N, Bassi MT, Borgatti R: A wide spectrum of clinical, neurophysiological and neuroradiological abnormalities in a family with a novel CACNA1A mutation. J Neurol Neurosurg Psychiatry. 2010 Aug;81(8):840-3. doi: 10.1136/jnnp.2008.163402. [PubMed:20682717 ]
  30. Mantuano E, Romano S, Veneziano L, Gellera C, Castellotti B, Caimi S, Testa D, Estienne M, Zorzi G, Bugiani M, Rajabally YA, Barcina MJ, Servidei S, Panico A, Frontali M, Mariotti C: Identification of novel and recurrent CACNA1A gene mutations in fifteen patients with episodic ataxia type 2. J Neurol Sci. 2010 Apr 15;291(1-2):30-6. doi: 10.1016/j.jns.2010.01.010. Epub 2010 Feb 2. [PubMed:20129625 ]