Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07496
Secondary Accession Numbers
  • 13204
Name Voltage-dependent T-type calcium channel subunit alpha-1H
Synonyms
  1. Low-voltage-activated calcium channel alpha1 3.2 subunit
  2. Voltage-gated calcium channel subunit alpha Cav3.2
Gene Name CACNA1H
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1H gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.3
SNPs CACNA1H
Gene Sequence
>7062 bp
ATGACCGAGGGCGCACGGGCCGCCGACGAGGTCCGGGTGCCCCTGGGCGCGCCGCCCCCT
GGCCCTGCGGCGTTGGTGGGGGCGTCCCCGGAGAGCCCCGGGGCGCCGGGACGCGAGGCG
GAGCGGGGGTCCGAGCTCGGCGTGTCACCCTCCGAGAGCCCGGCGGCCGAGCGCGGCGCG
GAGCTGGGTGCCGACGAGGAGCAGCGCGTCCCGTACCCGGCCTTGGCGGCCACGGTCTTC
TTCTGCCTCGGTCAGACCACGCGGCCGCGCAGCTGGTGCCTCCGGCTGGTCTGCAACCCA
TGGTTCGAGCACGTGAGCATGCTGGTAATCATGCTCAACTGCGTGACCCTGGGCATGTTC
CGGCCCTGTGAGGACGTTGAGTGCGGCTCCGAGCGCTGCAACATCCTGGAGGCCTTTGAC
GCCTTCATTTTCGCCTTTTTTGCGGTGGAGATGGTCATCAAGATGGTGGCCTTGGGGCTG
TTCGGGCAGAAGTGTTACCTGGGTGACACGTGGAACAGGCTGGATTTCTTCATCGTCGTG
GCGGGCATGATGGAGTACTCGTTGGACGGACACAACGTGAGCCTCTCGGCTATCAGGACC
GTGCGGGTGCTGCGGCCCCTCCGCGCCATCAACCGCGTGCCTAGCATGCGGATCCTGGTC
ACTCTGCTGCTGGATACGCTGCCCATGCTCGGGAACGTCCTTCTGCTGTGCTTCTTCGTC
TTCTTCATTTTCGGCATCGTTGGCGTCCAGCTCTGGGCTGGCCTCCTGCGGAACCGCTGC
TTCCTGGACAGTGCCTTTGTCAGGAACAACAACCTGACCTTCCTGCGGCCGTACTACCAG
ACGGAGGAGGGCGAGGAGAACCCGTTCATCTGCTCCTCACGCCGAGACAACGGCATGCAG
AAGTGCTCGCACATCCCCGGCCGCCGCGAGCTGCGCATGCCCTGCACCCTGGGCTGGGAG
GCCTACACGCAGCCGCAGGCCGAGGGGGTGGGCGCTGCACGCAACGCCTGCATCAACTGG
AACCAGTACTACAACGTGTGCCGCTCGGGTGACTCCAACCCCCACAACGGTGCCATCAAC
TTCGACAACATCGGCTACGCCTGGATCGCCATCTTCCAGGTGATCACGCTGGAAGGCTGG
GTGGACATCATGTACTACGTCATGGACGCCCACTCATTCTACAACTTCATCTATTTCATC
CTGCTCATCATCGTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACG
CAGTTCTCGGAGACGAAGCAGCGGGAGAGTCAGCTGATGCGGGAGCAGCGGGCACGCCAC
CTGTCCAACGACAGCACGCTGGCCAGCTTCTCCGAGCCTGGCAGCTGCTACGAAGAGCTG
CTGAAGTACGTGGGCCACATATTCCGCAAGGTCAAGCGGCGCAGCTTGCGCCTCTACGCC
CGCTGGCAGAGCCGCTGGCGCAAGAAGGTGGACCCCAGTGCTGTGCAAGGCCAGGGTCCC
GGGCACCGCCAGCGCCGGGCAGGCAGGCACACAGCCTCGGTGCACCACCTGGTCTACCAC
CACCATCACCACCACCACCACCACTACCATTTCAGCCATGGCAGCCCCCGCAGGCCCGGC
CCCGAGCCAGGCGCCTGCGACACCAGGCTGGTCCGAGCTGGCGCGCCCCCCTCGCCACCT
TCCCCAGGCCGCGGACCCCCCGACGCAGAGTCTGTGCACAGCATCTACCATGCCGACTGC
CACATAGAGGGGCCGCAGGAGAGGGCCCGGGTGGCACATGCCGCAGCCACTGCTGCTGCC
AGCCTCAGGCTGGCCACAGGGCTGGGCACCATGAACTACCCCACGATCCTGCCCTCAGGG
GTGGGCAGCGGCAAAGGCAGCACCAGCCCCGGACCCAAGGGGAAGTGGGCCGGTGGACCG
CCAGGCACCGGGGGGCACGGCCCGTTGAGCTTGAACAGCCCTGATCCCTACGAGAAGATC
CCGCATGTGGCCGGGGAGCATGGACTGGGCCAAGCCCCTGGCCATCTGTCGGGCCTCAGT
GTGCCCTGCCCCCTGCCCAGCCCCCCAGCGGGCACACTGACCTGTGAGCTGAAGAGCTGC
CCGTACTGCACCCGTGCCCTGGAGGACCCGGAGGGTGAGCTCAGCGGCTCGGAAAGTGGA
GACTCAGATGGCCGTGGCGTCTATGAATTCACGCAGGACGTCCGGCACGGTGACCGCTGG
GACCCCACGCGACCACCCCGTGCGACGGACACACCAGGCCCAGGCCCAGGCAGCCCCCAG
CGGCGGGCACAGCAGAGGGCAGCCCCGGGCGAGCCAGGCTGGATGGGCCGCCTCTGGGTT
ACCTTCAGCGGCAAGCTGCGCCGCATCGTGGACAGCAAGTACTTCAGCCGTGGCATCATG
ATGGCCATCCTTGTCAACACGCTGAGCATGGGCGTGGAGTACCATGAGCAGCCCGAGGAG
CTGACTAATGCTCTGGAGATCAGCAACATCGTGTTCACCAGCATGTTTGCCCTGGAGATG
CTGCTGAAGCTGCTGGCCTGCGGCCCTCTGGGCTACATCCGGAACCCGTACAACATCTTC
GACGGCATCATCGTGGTCATCAGCGTCTGGGAGATCGTGGGGCAGGCGGACGGTGGCTTG
TCTGTGCTGCGCACCTTCCGGCTGCTGCGTGTGCTGAAGCTGGTGCGCTTTCTGCCAGCC
CTGCGGCGCCAGCTCGTGGTGCTGGTGAAGACCATGGACAACGTGGCTACCTTCTGCACG
CTGCTCATGCTCTTCATTTTCATCTTCAGCATCCTGGGCATGCACCTTTTCGGCTGCAAG
TTCAGCCTGAAGACAGACACCGGAGACACCGTGCCTGACAGGAAGAACTTCGACTCCCTG
CTGTGGGCCATCGTCACCGTGTTCCAGATCCTGACCCAGGAGGACTGGAACGTGGTCCTG
TACAACGGCATGGCCTCCACCTCCTCCTGGGCCGCCCTCTACTTCGTGGCCCTCATGACC
TTCGGCAACTATGTGCTCTTCAACCTGCTGGTGGCCATCCTCGTGGAGGGCTTCCAGGCG
GAGGGCGATGCCAACAGATCCGACACGGACGAGGACAAGACGTCGGTCCACTTCGAGGAG
GACTTCCACAAGCTCAGAGAACTCCAGACCACAGAGCTGAAGATGTGTTCCCTGGCCGTG
ACCCCCAACGGGCACCTGGAGGGACGAGGCAGCCTGTCCCCTCCCCTCATCATGTGCACA
GCTGCCACGCCCATGCCTACCCCCAAGAGCTCACCATTCCTGGATGCAGCCCCCAGCCTC
CCAGACTCTCGGCGTGGCAGCAGCAGCTCCGGGGACCCGCCACTGGGAGACCAGAAGCCT
CCGGCCAGCCTCCGAAGTTCTCCCTGTGCCCCCTGGGGCCCCAGTGGCGCCTGGAGCAGC
CGGCGCTCCAGCTGGAGCAGCCTGGGCCGTGCCCCCAGCCTCAAGCGCCGCGGCCAGTGT
GGGGAACGTGAGTCCCTGCTGTCTGGCGAGGGCAAGGGCAGCACCGACGACGAAGCTGAG
GACGGCAGGGCCGCGCCCGGGCCCCGTGCCACCCCACTGCGGCGGGCCGAGTCCCTGGAC
CCACGGCCCCTGCGGCCGGCCGCCCTCCCGCCTACCAAGTGCCGCGATCGCGACGGGCAG
GTGGTGGCCCTGCCCAGCGACTTCTTCCTGCGCATCGACAGCCACCGTGAGGATGCAGCC
GAGCTTGACGACGACTCGGAGGACAGCTGCTGCCTCCGCCTGCATAAAGTGCTGGAGCCC
TACAAGCCCCAGTGGTGCCGGAGCCGCGAGGCCTGGGCCCTCTACCTCTTCTCCCCACAG
AACCGGTTCCGCGTCTCCTGCCAGAAGGTCATCACACACAAGATGTTTGATCACGTGGTC
CTCGTCTTCATCTTCCTCAACTGCGTCACCATCGCCCTGGAGAGGCCTGACATTGATCCC
GGCAGCACCGAGCGGGTCTTCCTCAGCGTCTCCAATTACATCTTCACGGCCATCTTCGTG
GCGGAGATGATGGTGAAGGTGGTGGCCCTGGGGCTGCTGTCCGGCGAGCACGCCTACCTG
CAGAGCAGCTGGAACCTGCTGGATGGGCTGCTGGTGCTGGTGTCCCTGGTGGACATTGTC
GTGGCCATGGCCTCGGCTGGTGGCGCCAAGATCCTGGGTGTTCTGCGCGTGCTGCGTCTG
CTGCGGACCCTGCGGCCTCTGAGGGTCATCAGCCGGGCCCCGGGCCTCAAGCTGGTGGTG
GAGACGCTGATATCATCACTCAGGCCCATTGGGAACATCGTCCTCATCTGCTGCGCCTTC
TTCATCATTTTTGGCATTTTGGGTGTGCAGCTCTTCAAAGGGAAGTTCTACTACTGCGAG
GGCCCCGACACCAGGAACATCTCCACCAAGGCACAGTGCCGGGCCGCCCACTACCGCTGG
GTGCGACGCAAGTACAACTTCGACAACCTGGGCCAGGCCCTGATGTCGCTGTTCGTGCTG
TCATCCAAGGATGGATGGGTGAACATCATGTACGACGGGCTGGATGCCGTGGGTGTCGAC
CAGCAGCCTGTGCAGAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTGCTC
ATCGTCAGCTTCTTCGTGCTCAACATGTTCGTGGGCGTCGTGGTCGAGAACTTCCACAAG
TGCCGGCAGCACCAGGAGGCGGAGGAGGCGCGGCGGCGAGAGGAGAAGCGGCTGCGGCGC
CTAGAGAGGAGGCGCAGGAGCACTTTCCCCAGCCCAGAGGCCCAGCGCCGGCCCTACTAT
GCCGACTACTCGCCCACGCGCCGCTCCATTCACTCGCTGTGCACCAGCCACTATCTCGAC
CTCTTCATCACCTTCATCATCTGTGTCAACGTCATCACCATGTCCATGGAGCACTATAAC
CAACCCAAGTCGCTGGACGAGGCCCTCAAGTACTGCAACTACGTCTTCACCATCGTGTTT
GTCTTCGAGGCTGCACTGAAGCTGGTAGCATTTGGGTTCCGTCGGTTCTTCAAGGACAGG
TGGAACCAGCTGGACCTGGCCATCGTGCTGCTGTCACTCATGGGCATCACGCTGGAGGAG
ATAGAGATGAGCGCCGCGCTGCCCATCAACCCCACCATCATCCGCATCATGCGCGTGCTT
CGCATTGCCCGTGTGCTGAAGCTGCTGAAGATGGCTACGGGCATGCGCGCCCTGCTGGAC
ACTGTGGTGCAAGCTCTCCCCCAGGTGGGGAACCTGGGCCTTCTTTTCATGCTCCTGTTT
TTTATCTATGCTGCGCTGGGAGTGGAGCTGTTCGGGAGGCTGGAGTGCAGTGAAGACAAC
CCCTGCGAGGGCCTGAGCAGGCACGCCACCTTCAGCAACTTCGGCATGGCCTTCCTCACG
CTGTTCCGCGTGTCCACGGGGGACAACTGGAACGGGATCATGAAGGACACGCTGCGCGAG
TGCTCCCGTGAGGACAAGCACTGCCTGAGCTACCTGCCGGCCCTGTCGCCCGTCTACTTC
GTGACCTTCGTGCTGGTGGCCCAGTTCGTGCTGGTGAACGTGGTGGTGGCCGTGCTCATG
AAGCACCTGGAGGAGAGCAACAAGGAGGCACGGGAGGATGCGGAGCTGGACGCCGAGATC
GAGCTGGAGATGGCGCAGGGCCCCGGGAGTGCACGCCGGGTGGACGCGGACAGGCCTCCC
TTGCCCCAGGAGAGTCCGGGCGCCAGGGATGCCCCAAACCTGGTTGCACGCAAGGTGTCC
GTGTCCAGGATGCTCTCGCTGCCCAACGACAGCTACATGTTCAGGCCCGTGGTGCCTGCC
TCGGCGCCCCACCCCCGCCCGCTGCAGGAGGTGGAGATGGAGACCTATGGGGCCGGCACC
CCCTTGGGCTCCGTTGCCTCTGTGCACTCTCCGCCCGCAGAGTCCTGTGCCTCCCTCCAG
ATCCCACTGGCTGTGTCGTCCCCAGCCAGGAGCGGCGAGCCCCTCCACGCCCTGTCCCCT
CGGGGCACAGCCCGCTCCCCCAGTCTCAGCCGGCTGCTCTGCAGACAGGAGGCTGTGCAC
ACCGATTCCTTGGAAGGGAAGATTGACAGCCCTAGGGACACCCTGGATCCTGCAGAGCCT
GGTGAGAAAACCCCGGTGAGGCCGGTGACCCAGGGGGGCTCCCTGCAGTCCCCACCACGC
TCCCCACGGCCCGCCAGCGTCCGCACTCGTAAGCATACCTTCGGACAGCGCTGCGTCTCC
AGCCGGCCGGCGGCCCCAGGCGGAGAGGAGGCCGAGGCCTCGGACCCAGCCGACGAGGAG
GTCAGCCACATCACCAGCTCCGCCTGCCCCTGGCAGCCCACAGCCGAGCCCCATGGCCCC
GAAGCCTCTCCGGTGGCCGGCGGCGAGCGGGACCTGCGCAGGCTCTACAGCGTGGATGCT
CAGGGCTTCCTGGACAAGCCGGGCCGGGCAGACGAGCAGTGGCGGCCCTCGGCGGAGCTG
GGCAGCGGGGAGCCTGGGGAGGCGAAGGCCTGGGGCCCTGAGGCCGAGCCCGCTCTGGGT
GCGCGCAGAAAGAAGAAGATGAGCCCCCCCTGCATCTCGGTGGAACCCCCTGCGGAGGAC
GAGGGCTCTGCGCGGCCCTCCGCGGCAGAGGGCGGCAGCACCACACTGAGGCGCAGGACC
CCGTCCTGTGAGGCCACGCCTCACAGGGACTCCCTGGAGCCCACAGAGGGCTCAGGCGCC
GGGGGGGACCCTGCAGCCAAGGGGGAGCGCTGGGGCCAGGCCTCCTGCCGGGCTGAGCAC
CTGACCGTCCCCAGCTTTGCCTTTGAGCCGCTGGACCTCGGGGTCCCCAGTGGAGACCCT
TTCTTGGACGGTAGCCACAGTGTGACCCCAGAATCCAGAGCTTCCTCTTCAGGGGCCATA
GTGCCCCTGGAACCCCCAGAATCAGAGCCTCCCATGCCCGTCGGTGACCCCCCAGAGAAG
AGGCGGGGGCTGTACCTCACAGTCCCCCAGTGTCCTCTGGAGAAACCAGGGTCCCCCTCA
GCCACCCCTGCCCCAGGGGGTGGTGCAGATGACCCCGTGTAG
Protein Properties
Number of Residues 2353
Molecular Weight 259160.2
Theoretical pI 7.38
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 101-119
  • 140-160
  • 170-184
  • 194-212
  • 233-253
  • 395-419
  • 794-814
  • 828-849
  • 856-874
  • 883-906
  • 918-938
  • 991-1015
  • 1291-1313
  • 1332-1352
  • 1363-1382
  • 1397-1418
  • 1429-1452
  • 1530-1555
  • 1617-1637
  • 1652-1673
  • 1681-1699
  • 1714-1737
  • 1752-1772
  • 1836-1863
Protein Sequence
>Voltage-dependent T-type calcium channel subunit alpha-1H
MTEGARAADEVRVPLGAPPPGPAALVGASPESPGAPGREAERGSELGVSPSESPAAERGA
ELGADEEQRVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMF
RPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGLFGQKCYLGDTWNRLDFFIVV
AGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFV
FFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQ
KCSHIPGRRELRMPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSGDSNPHNGAIN
FDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT
QFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYA
RWQSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPG
PEPGACDTRLVRAGAPPSPPSPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAA
SLRLATGLGTMNYPTILPSGVGSGKGSTSPGPKGKWAGGPPGTGGHGPLSLNSPDPYEKI
PHVVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSESG
DSDGRGVYEFTQDVRHGDRWDPTRPPRATDTPGPGPGSPQRRAQQRAAPGEPGWMGRLWV
TFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEM
LLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPA
LRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSL
LWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQA
EGDANRSDTDEDKTSVHFEEDFHKLRELQTTELKMCSLAVTPNGHLEGRGSLSPPLIMCT
AATPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPWGPSGAWSS
RRSSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAPGPRATPLRRAESLD
PRPLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEP
YKPQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDP
GSTERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIV
VAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAF
FIIFGILGVQLFKGKFYYCEGPDTRNISTKAQCRAAHYRWVRRKYNFDNLGQALMSLFVL
SSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHK
CRQHQEAEEARRREEKRLRRLERRRRSTFPSPEAQRRPYYADYSPTRRSIHSLCTSHYLD
LFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDR
WNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLD
TVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLT
LFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLM
KHLEESNKEAREDAELDAEIELEMAQGPGSARRVDADRPPLPQESPGARDAPNLVARKVS
VSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCASLQ
IPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDSPRDTLDPAEP
GEKTPVRPVTQGGSLQSPPRSPRPASVRTRKHTFGQRCVSSRPAAPGGEEAEASDPADEE
VSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAEL
GSGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPSAAEGGSTTLRRRT
PSCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSGDP
FLDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGSPS
ATPAPGGGADDPV
GenBank ID Protein 14670397
UniProtKB/Swiss-Prot ID O95180
UniProtKB/Swiss-Prot Entry Name CAC1H_HUMAN
PDB IDs Not Available
GenBank Gene ID AF051946
GeneCard ID CACNA1H
GenAtlas ID CACNA1H
HGNC ID HGNC:1395
References
General References
  1. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  4. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. [PubMed:11157797 ]
  5. Cribbs LL, Lee JH, Yang J, Satin J, Zhang Y, Daud A, Barclay J, Williamson MP, Fox M, Rees M, Perez-Reyes E: Cloning and characterization of alpha1H from human heart, a member of the T-type Ca2+ channel gene family. Circ Res. 1998 Jul 13;83(1):103-9. [PubMed:9670923 ]
  6. Williams ME, Washburn MS, Hans M, Urrutia A, Brust PF, Prodanovich P, Harpold MM, Stauderman KA: Structure and functional characterization of a novel human low-voltage activated calcium channel. J Neurochem. 1999 Feb;72(2):791-9. [PubMed:9930755 ]
  7. Jagannathan S, Punt EL, Gu Y, Arnoult C, Sakkas D, Barratt CL, Publicover SJ: Identification and localization of T-type voltage-operated calcium channel subunits in human male germ cells. Expression of multiple isoforms. J Biol Chem. 2002 Mar 8;277(10):8449-56. Epub 2001 Dec 21. [PubMed:11751928 ]
  8. Chen Y, Lu J, Pan H, Zhang Y, Wu H, Xu K, Liu X, Jiang Y, Bao X, Yao Z, Ding K, Lo WH, Qiang B, Chan P, Shen Y, Wu X: Association between genetic variation of CACNA1H and childhood absence epilepsy. Ann Neurol. 2003 Aug;54(2):239-43. [PubMed:12891677 ]