Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07497
Secondary Accession Numbers
  • 13205
Name Voltage-dependent T-type calcium channel subunit alpha-1I
Synonyms
  1. Ca(v)3.3
  2. Voltage-gated calcium channel subunit alpha Cav3.3
Gene Name CACNA1I
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
ion channel complex
cation channel complex
macromolecular complex
intrinsic to membrane
protein complex
integral to membrane
calcium channel complex
voltage-gated calcium channel complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs CACNA1I
Gene Sequence
>6672 bp
ATGGCTGAGAGCGCCTCCCCGCCCTCCTCATCTGCAGCAGCCCCAGCCGCTGAGCCAGGA
GTCACCACGGAGCAGCCCGGACCCCGGAGCCCCCCATCCTCCCCGCCAGGCCTGGAGGAG
CCTCTGGATGGAGCTGATCCTCATGTCCCACACCCAGACCTGGCGCCTATTGCCTTCTTC
TGCCTGCGACAGACCACCAGCCCCCGGAACTGGTGCATCAAGATGGTGTGCAACCCGTGG
TTTGAATGTGTCAGCATGCTGGTGATCCTGCTGAACTGCGTGACACTTGGCATGTACCAG
CCGTGCGACGACATGGACTGCCTGTCCGACCGCTGCAAGATCCTGCAGGTCTTTGATGAC
TTCATCTTTATCTTCTTTGCCATGGAGATGGTGCTCAAGATGGTGGCCCTGGGGATTTTT
GGCAAGAAGTGCTACCTCGGGGACACATGGAACCGCCTGGATTTCTTCATCGTCATGGCA
GGGATGGTCGAGTACTCCCTGGACCTTCAGAACATCAACCTGTCAGCCATCCGCACCGTG
CGCGTCCTGAGGCCCCTCAAAGCCATCAACCGCGTGCCCAGTATGCGGATCCTGGTGAAC
CTGCTCCTGGACACACTGCCCATGCTGGGGAATGTCCTGCTGCTCTGCTTCTTTGTCTTC
TTCATCTTTGGCATCATAGGTGTGCAGCTCTGGGCGGGCCTGCTGCGTAACCGCTGCTTC
CTGGAGGAGAACTTCACCATACAAGGGGATGTGGCCTTGCCCCCATACTACCAGCCGGAG
GAGGATGATGAGATGCCCTTCATCTGCTCCCTGTCGGGCGACAATGGGATAATGGGCTGC
CATGAGATCCCCCCGCTCAAGGAGCAGGGCCGTGAGTGCTGCCTGTCCAAGGACGACGTC
TACGACTTTGGGGCGGGGCGCCAGGACCTCAATGCCAGCGGCCTCTGTGTCAACTGGAAC
CGTTACTACAATGTGTGCCGCACGGGCAGCGCCAACCCCCACAAGGGTGCCATCAACTTT
GACAACATCGGTTATGCTTGGATTGTCATCTTCCAGGTGATCACTCTGGAAGGCTGGGTG
GAGATCATGTACTACGTGATGGATGCTCACTCCTTCTACAACTTCATCTACTTCATCCTG
CTTATCATAGTGGGCTCCTTCTTCATGATCAACCTGTGCCTCGTTGTCATAGCGACCCAG
TTCTCGGAGACCAAGCAACGGGAGCACCGGCTGATGCTGGAGCAGCGGCAGCGCTACCTG
TCCTCCAGCACGGTGGCCAGCTACGCCGAGCCTGGCGACTGCTACGAGGAGATCTTCCAG
TATGTCTGCCACATCCTGCGCAAGGCCAAGCGCCGCGCCCTGGGCCTCTACCAGGCCCTG
CAGAGCCGGCGCCAGGCCCTGGGCCCGGAGGCCCCGGCCCCCGCCAAACCTGGGCCCCAC
GCCAAGGAGCCCCGGCACTACCATGGGAAGACTAAGGGTCAGGGAGATGAAGGGAGACAT
CTCGGAAGCCGGCATTGCCAGACTTTGCATGGGCCTGCCTCCCCTGGAAATGATCACTCG
GGAAGAGAGCTGTGCCCGCAACATAGCCCCCTGGATGCGACGCCCCACACCCTGGTGCAG
CCCATCCCCGCCACGCTGGCTTCCGATCCCGCCAGCTGCCCTTGCTGCCAGCATGAGGAC
GGCCGGCGGCCCTCGGGCCTGGGCAGCACCGACTCGGGCCAGGAGGGCTCGGGCTCCGGG
AGCTCCGCTGGTGGCGAGGACGAGGCGGATGGGGACGGGGCCCGGAGCAGCGAGGACGGA
GCCTCCTCAGAACTGGGGAAGGAGGAGGAGGAGGAGGAGCAGGCGGATGGGGCGGTCTGG
CTGTGCGGGGATGTGTGGCGGGAGACGCGAGCCAAGCTGCGCGGCATCGTGGACAGCAAG
TACTTCAACCGGGGCATCATGATGGCCATCCTGGTCAACACCGTCAGCATGGGCATCGAG
CACCACGAGCAGCCGGAGGAGCTGACCAACATCCTGGAGATCTGCAATGTGGTCTTCACC
AGCATGTTTGCCCTGGAGATGATCCTGAAGCTGGCTGCATTTGGGCTCTTCGACTACCTG
CGTAACCCCTACAACATCTTCGACAGCATCATTGTCATCATCAGCATCTGGGAGATTGTG
GGGCAGGCGGACGGTGGGCTGTCGGTGCTGCGGACCTTCCGGCTGCTGCGCGTGCTGAAA
CTGGTGCGCTTCATGCCTGCCCTGCGGCGCCAGCTCGTGGTGCTCATGAAGACCATGGAC
AACGTGGCCACCTTCTGCATGCTGCTCATGCTCTTCATCTTCATCTTCAGCATCCTTGGG
ATGCATATTTTTGGCTGCAAGTTCAGCCTCCGCACGGACACTGGAGACACGGTGCCCGAC
AGGAAGAACTTCGACTCCCTGCTGTGGGCCATCGTCACTGTGTTCCAGATCCTCACCCAG
GAGGACTGGAACGTCGTTCTCTACAATGGCATGGCCTCCACTTCTCCCTGGGCCTCCCTC
TACTTTGTCGCCCTCATGACCTTCGGCAACTATGTGCTCTTCAACCTGCTGGTGGCCATC
CTGGTGGAGGGCTTCCAGGCGGAGGGTGACGCCAATCGCTCCTACTCGGACGAGGACCAG
AGCTCATCCAACATAGAAGAGTTTGATAAGCTCCAGGAAGGCCTGGACAGCAGCGGAGAT
CCCAAGCTCTGCCCAATCCCCATGACCCCCAATGGGCACCTGGACCCCAGTCTCCCACTG
GGTGGGCACCTAGGTCCTGCTGGGGCTGCGGGACCTGCCCCCCGACTCTCACTGCAGCCG
GACCCCATGCTGGTGGCCCTGGGCTCCCGAAAGAGCAGTGTCATGTCTCTAGGGAGGATG
AGCTATGACCAGCGCTCCCTGTCCAGCTCCCGGAGCTCCTACTACGGGCCATGGGGCCGC
AGCGCGGCCTGGGCCAGCCGTCGCTCCAGCTGGAACAGCCTCAAGCACAAGCCGCCGTCG
GCGGAGCATGAGTCCCTGCTCTCTGCGGAGCGCGGCGGCGGCGCCCGGGTCTGCGAGGTT
GCCGCGGACGAGGGGCCGCCGCGGGCCGCACCCCTGCACACCCCACACGCCCACCACATT
CATCACGGGCCCCATCTGGCGCACCGCCACCGCCACCACCGCCGGACGCTGTCCCTCGAC
AACAGGGACTCGGTGGACCTGGCCGAGCTGGTGCCCGCGGTGGGCGCCCACCCCCGGGCC
GCCTGGAGGGCGGCAGGCCCGGCCCCCGGGCATGAGGACTGCAATGGCAGGATGCCCAGC
ATCGCCAAAGACGTCTTCACCAAGATGGGCGACCGCGGGGATCGCGGGGAGGATGAGGAG
GAAATCGACTACACCCTGTGCTTCCGCGTCCGCAAGATGATCGACGTCTATAAGCCCGAC
TGGTGCGAGGTCCGCGAAGACTGGTCTGTCTACCTCTTCTCTCCCGAGAACAGGTTCCGG
GTCCTGTGTCAGACCATTATTGCCCACAAACTCTTCGACTACGTCGTCCTGGCCTTCATC
TTTCTCAACTGCATCACCATCGCCCTGGAGCGGCCTCAGATCGAGGCCGGCAGCACCGAA
CGCATCTTTCTCACCGTGTCCAACTACATCTTCACGGCCATCTTCGTGGGCGAGATGACA
TTGAAGGTAGTCTCGCTGGGCCTGTACTTCGGCGAGCAGGCGTACCTACGCAGCAGCTGG
AACGTGCTGGATGGCTTTCTTGTCTTCGTGTCCATCATCGACATCGTGGTGTCCCTGGCC
TCAGCCGGGGGAGCCAAGATCTTGGGGGTCCTCCGAGTCTTGCGGCTCCTGCGCACCCTA
CGCCCCCTGCGTGTCATCAGCCGGGCGCCGGGCCTGAAGCTGGTGGTGGAGACACTCATC
TCCTCCCTCAAGCCCATCGGCAACATCGTGCTCATCTGCTGTGCCTTCTTCATCATCTTT
GGCATCCTGGGAGTGCAGCTCTTCAAGGGCAAGTTCTACCACTGTCTGGGCGTGGACACC
CGCAACATCACCAACCGCTCGGACTGCATGGCCGCCAACTACCGCTGGGTCCATCACAAA
TACAACTTCGACAACCTGGGCCAGGCTCTGATGTCCCTCTTTGTCCTGGCATCCAAGGAT
GGTTGGGTGAACATCATGTACAATGGACTGGATGCTGTTGCTGTGGACCAGCAGCCTGTG
ACCAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTGCTCATCGTCAGCTTC
TTTGTGCTCAACATGTTTGTGGGTGTCGTGGTGGAGAACTTCCACAAGTGCCGGCAGCAC
CAGGAGGCTGAAGAGGCACGGCGGCGTGAGGAGAAGCGGCTGCGGCGCCTGGAGAAGAAG
CGCCGGAAGGCCCAGCGGCTGCCCTACTATGCCACCTATTGTCACACCCGGCTGCTCATC
CACTCCATGTGCACCAGCCACTACCTGGACATCTTCATCACCTTCATCATCTGCCTCAAC
GTGGTCACCATGTCCCTGGAGCACTACAATCAGCCCACGTCCCTGGAGACAGCCCTCAAG
TACTGCAACTATATGTTCACCACTGTCTTTGTGCTGGAGGCTGTGCTGAAGCTGGTGGCA
TTTGGTCTGAGGCGCTTCTTCAAGGACCGATGGAACCAGCTGGACCTGGCCATTGTGCTA
CTGTCAGTCATGGGCATCACCCTGGAGGAGATCGAGATCAATGCGGCCCTGCCCATCAAT
CCCACCATCATCCGCATCATGAGGGTTCTGCGCATTGCCCGAGTGCTGAAGCTGTTGAAG
ATGGCCACAGGAATGCGGGCCCTGCTGGACACGGTGGTGCAAGCTTTGCCCCAGGTGGGC
AACCTGGGCCTCCTCTTCATGCTGCTCTTCTTCATCTATGCTGCTCTCGGGGTGGAGCTC
TTTGGGAAGCTGGTCTGCAACGACGAGAACCCGTGCGAGGGCATGAGCCGGCATGCCACC
TTCGAGAACTTCGGCATGGCCTTCCTCACACTCTTCCAGGTCTCCACGGGTGACAACTGG
AACGGGATCATGAAGGACACGCTGCGGGACTGCACCCACGACGAGCGCAGCTGCCTGAGC
AGCCTGCAGTTTGTGTCGCCGCTGTACTTCGTGAGCTTCGTGCTCACCGCGCAGTTCGTG
CTCATCAACGTGGTGGTGGCTGTGCTCATGAAGCACCTGGACGACAGCAACAAGGAGGCG
CAGGAGGACGCCGAGATGGATGCCGAGCTCGAGCTGGAGATGGCCCATGGCCTGGGCCCT
GGCCCGAGGCTGCCTACCGGCTCCCCGGGCGCCCCTGGCCGAGGGCCGGGAGGGGCGGGC
GGCGGGGGCGACACCGAGGGCGGCTTGTGCCGGCGCTGCTACTCGCCTGCCCAGGAGAAC
CTGTGGCTGGACAGCGTCTCTTTAATCATCAAGGACTCCTTGGAGGGGGAGCTGACCATC
ATCGACAACCTGTCGGGCTCCATCTTCCACCACTACTCCTCGCCTGCCGGCTGCAAGAAG
TGTCACCACGACAAGCAAGAGGTGCAGCTGGCTGAGACGGAGGCCTTCTCCCTGAACTCA
GACAGGTCCTCGTCCATCCTGCTGGGTGACGACCTGAGTCTCGAGGACCCCACAGCCTGC
CCACCTGGCCGCAAAGACAGCAAGGGTGAGCTGGACCCACCTGAGCCCATGCGTGTGGGA
GACCTGGGCGAATGCTTCTTCCCCTTGTCCTCTACGGCCGTCTCGCCGGATCCAGAGAAC
TTCCTGTGTGAGATGGAGGAGATCCCATTCAACCCTGTCCGGTCCTGGCTGAAACATGAC
AGCAGTCAAGCACCCCCAAGTCCCTTCTCCCCGGATGCCTCCAGCCCTCTCCTGCCCATG
CCAGCCGAGTTCTTCCACCCTGCAGTGTCTGCCAGCCAGAAAGGCCCAGAAAAGGGCACT
GGCACTGGAACCCTCCCCAAGATTGCGCTGCAGGGCTCCTGGGCATCTCTGCGGTCACCA
AGGGTCAACTGTACCCTCCTCCGGCAGGCCACCGGGAGCGACACGTCGCTGGACGCCAGC
CCCAGCAGCTCCGCGGGCAGCCTGCAGACCACGCTCGAGGACAGCCTGACCCTGAGCGAC
AGCCCCCGGCGTGCCCTGGGGCCGCCCGCGCCTGCTCCAGGACCCCGGGCCGGCCTGTCC
CCCGCCGCTCGCCGCCGCCTGAGCCTGCGCGGCCGGGGCCTCTTCAGCCTGCGGGGGCTG
CGGGCGCATCAGCGCAGCCACAGCAGCGGGGGCTCCACCAGCCCGGGCTGCACCCACCAC
GACTCCATGGACCCCTCGGACGAGGAGGGCCGCGGTGGCGCGGGCGGCGGGGGCGCGGGC
AGCGAGCACTCGGAGACCCTCAGCAGCCTCTCGCTCACCTCCCTCTTCTGCCCGCCGCCC
CCGCCGCCAGCCCCCGGCCTCACGCCCGCCAGGAAGTTCAGCAGCACCAGCAGCCTGGCC
GCCCCCGGCCGCCCCCACGCCGCCGCCCTGGCCCACGGCCTGGCCCGGAGCCCCTCGTGG
GCCGCGGACCGCAGCAAGGACCCCCCCGGCCGGGCACCGCTGCCCATGGGCCTGGGCCCC
TTGGCGCCCCCGCCGCAACCGCTCCCCGGAGAGCTGGAGCCGGGAGACGCCGCCAGCAAG
AGGAAGAGATGA
Protein Properties
Number of Residues 2223
Molecular Weight 245100.8
Theoretical pI 6.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 79-99
  • 121-141
  • 149-168
  • 174-191
  • 212-232
  • 378-398
  • 641-661
  • 677-697
  • 703-721
  • 730-753
  • 765-785
  • 842-862
  • 1167-1187
  • 1210-1230
  • 1245-1265
  • 1273-1294
  • 1305-1325
  • 1411-1431
  • 1486-1506
  • 1523-1543
  • 1557-1577
  • 1584-1607
  • 1622-1642
  • 1710-1730
Protein Sequence
>Voltage-dependent T-type calcium channel subunit alpha-1I
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYHGKTKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQ
PIPATLASDPASCPCCQHEDGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDG
ASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIE
HHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGD
PKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRM
SYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEV
AADEGPPRAAPLHTPHAHHIHHGPHLAHRHRHHRRTLSLDNRDSVDLAELVPAVGAHPRA
AWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPD
WCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTE
RIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLN
VVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAELELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQEN
LWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNS
DRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPEN
FLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKGT
GTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSD
SPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLA
APGRPHAAALAHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASK
RKR
GenBank ID Protein 21361077
UniProtKB/Swiss-Prot ID Q9P0X4
UniProtKB/Swiss-Prot Entry Name CAC1I_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_021096.3
GeneCard ID CACNA1I
GenAtlas ID CACNA1I
HGNC ID HGNC:1396
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  2. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  3. Mittman S, Guo J, Emerick MC, Agnew WS: Structure and alternative splicing of the gene encoding alpha1I, a human brain T calcium channel alpha1 subunit. Neurosci Lett. 1999 Jul 16;269(3):121-4. [PubMed:10454147 ]
  4. Monteil A, Chemin J, Leuranguer V, Altier C, Mennessier G, Bourinet E, Lory P, Nargeot J: Specific properties of T-type calcium channels generated by the human alpha 1I subunit. J Biol Chem. 2000 Jun 2;275(22):16530-5. [PubMed:10749850 ]
  5. Gomora JC, Murbartian J, Arias JM, Lee JH, Perez-Reyes E: Cloning and expression of the human T-type channel Ca(v)3.3: insights into prepulse facilitation. Biophys J. 2002 Jul;83(1):229-41. [PubMed:12080115 ]
  6. Zhang D, Chen J, Saraf A, Cassar S, Han P, Rogers JC, Brioni JD, Sullivan JP, Gopalakrishnan M: Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity. J Biol Chem. 2006 Aug 4;281(31):22332-41. Epub 2006 Jun 1. [PubMed:16740636 ]