You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07504
Secondary Accession Numbers
  • 13212
Name Cadherin-10
Synonyms
  1. T2-cadherin
Gene Name CDH10
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:5
Locus 5p14.2
SNPs CDH10
Gene Sequence
>2367 bp
ATGACAATACATCAATTTTTGCTACTGTTTCTATTCTGGGTATGCCTGCCACATTTCTGC
TCTCCAGAAATAATGTTCAGAAGGACGCCTGTGCCACAGCAAAGAATTTTAAGTTCACGT
GTACCAAGGAGTGATGGCAAAATTCTCCATCGTCAAAAACGTGGTTGGATGTGGAATCAA
TTTTTCTTACTTGAAGAATATACAGGATCTGATTATCAGTACGTAGGCAAGCTACATTCA
GACCAAGATAAAGGAGATGGATCACTCAAATATATCTTATCTGGAGATGGAGCTGGTACT
CTTTTTATTATTGATGAAAAAACAGGTGATATTCATGCCACAAGGCGAATTGATAGGGAG
GAAAAGGCCTTTTATACTCTACGCGCACAAGCTATTAACAGAAGAACTCTGAGGCCAGTA
GAGCCAGAGTCAGAGTTTGTGATCAAAATTCATGATATCAATGACAATGAGCCAACGTTC
CCAGAAGAAATCTATACAGCTAGTGTTCCCGAAATGTCTGTTGTAGGTACTTCTGTGGTG
CAAGTCACAGCTACAGATGCCGATGACCCTTCATATGGGAACAGCGCCAGAGTCATTTAC
AGCATACTTCAAGGGCAGCCCTATTTCTCTGTGGAGCCTGAAACAGGTATCATCAGGACT
GCTTTACCGAACATGAACAGAGAAAACAGAGAGCAATACCAAGTGGTCATCCAGGCCAAA
GACATGGGCGGCCAGATGGGAGGCTTATCGGGGACAACCACTGTGAACATCACGCTGACA
GATGTCAATGACAACCCACCACGTTTCCCCCAGAACACTATTCATCTTCGAGTTCTTGAA
TCCTCCCCAGTTGGCACAGCCATTGGAAGTGTCAAAGCAACTGATGCTGACACTGGGAAA
AATGCTGAAGTAGAATACCGAATTATTGATGGTGACGGTACTGATATGTTTGACATCGTG
ACTGAGAAGGACACACAGGAAGGCATCATCACTGTGAAAAAGCCACTCGACTATGAGAGC
CGAAGACTTTATACTCTGAAAGTCGAAGCAGAAAACACCCATGTAGATCCCCGTTTTTAT
TACCTAGGACCATTTAAAGATACTACCATAGTGAAAATCTCTATAGAAGATGTGGATGAA
CCTCCTGTTTTTAGTAGGTCCTCCTATCTGTTTGAAGTTCATGAAGATATTGAAGTGGGC
ACAATCATTGGTACTGTAATGGCAAGGGACCCAGATTCTATTTCCAGCCCCATTAGATTT
TCCTTGGATCGCCATACTGACCTTGACAGAATCTTTAACATTCATTCAGGAAATGGATCT
CTTTATACATCAAAACCTCTTGACCGTGAACTATCTCAGTGGCATAATCTTACTGTTATT
GCTGCTGAAATCAACAATCCCAAAGAGACAACACGCGTGGCTGTTTTTGTGAGAATTTTG
GATGTTAATGACAATGCCCCACAGTTTGCTGTGTTCTATGACACTTTTGTATGTGAAAAT
GCCAGACCAGGGCAGCTAATACAGACTATAAGTGCAGTAGACAAAGATGACCCTTTAGGT
GGACAGAAATTTTTTTTCAGTTTAGCTGCTGTCAATCCAAACTTCACAGTACAGGATAAT
GAAGATAATACTGCCAGAATCTTAACCAGAAAAAATGGATTCAATAGACATGAAATCAGT
ACCTATCTCTTGCCTGTGGTGATATCAGACAATGATTACCCAATTCAGAGCAGCACAGGC
ACACTGACCATTCGAGTGTGTGCTTGTGACAGCCAAGGCAACATGCAATCCTGCAGTGCT
GAAGCCCTGCTCCTCCCTGCCGGCCTCAGCACTGGGGCCTTGATCGCCATCCTCCTCTGC
ATCATCATTCTACTGGTTATAGTAGTACTGTTTGCAGCTCTGAAAAGACAGCGAAAAAAA
GAGCCTCTGATCTTGTCAAAAGAAGATATCAGAGACAACATTGTGAGCTATAACGATGAG
GGTGGTGGAGAGGAGGACACCCAGGCCTTTGATATCGGCACCCTGAGGAATCCTGCAGCC
ATTGAGGAAAAAAAGCTCCGGCGAGATATTATTCCAGAAACGTTATTTATTCCTCGGAGG
ACTCCTACAGCTCCAGATAACACGGACGTCCGGGATTTCATTAATGAAAGGCTAAAAGAG
CATGATCTTGACCCCACCGCACCCCCCTACGACTCACTTGCAACCTATGCCTATGAAGGA
AATGATTCCATTGCTGAATCTCTGAGTTCATTAGAATCAGGTACTACTGAAGGAGACCAA
AACTACGATTACCTCCGAGAATGGGGCCCTCGGTTTAATAAGCTAGCAGAAATGTATGGT
GGTGGGGAAAGTGACAAAGACTCTTAA
Protein Properties
Number of Residues 788
Molecular Weight 88450.4
Theoretical pI 4.59
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 614-634
Protein Sequence
>Cadherin-10
MTIHQFLLLFLFWVCLPHFCSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQ
FFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDRE
EKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVV
QVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAK
DMGGQMGGLSGTTTVNITLTDVNDNPPRFPQNTIHLRVLESSPVGTAIGSVKATDADTGK
NAEVEYRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRLYTLKVEAENTHVDPRFY
YLGPFKDTTIVKISIEDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRF
SLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRIL
DVNDNAPQFAVFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDN
EDNTARILTRKNGFNRHEISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSA
EALLLPAGLSTGALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDE
GGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKE
HDLDPTAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQNYDYLREWGPRFNKLAEMYG
GGESDKDS
GenBank ID Protein 6483303
UniProtKB/Swiss-Prot ID Q9Y6N8
UniProtKB/Swiss-Prot Entry Name CAD10_HUMAN
PDB IDs Not Available
GenBank Gene ID AB035303
GeneCard ID CDH10
GenAtlas ID CDH10
HGNC ID HGNC:1749
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Kools P, Vanhalst K, Van den Eynde E, van Roy F: The human cadherin-10 gene: complete coding sequence, predominant expression in the brain, and mapping on chromosome 5p13-14. FEBS Lett. 1999 Jun 11;452(3):328-34. [PubMed:10386616 ]
  4. Shimoyama Y, Tsujimoto G, Kitajima M, Natori M: Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins. Biochem J. 2000 Jul 1;349(Pt 1):159-67. [PubMed:10861224 ]