Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07505
Secondary Accession Numbers
  • 13213
Name Cadherin-11
Synonyms
  1. OB-cadherin
  2. OSF-4
  3. Osteoblast cadherin
Gene Name CDH11
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs CDH11
Gene Sequence
>2391 bp
ATGAAGGAGAACTACTGTTTACAAGCCGCCCTGGTGTGCCTGGGCATGCTGTGCCACAGC
CATGCCTTTGCCCCAGAGCGGCGGGGGCACCTGCGGCCCTCCTTCCATGGGCACCATGAG
AAGGGCAAGGAGGGGCAGGTGCTACAGCGCTCCAAGCGTGGCTGGGTCTGGAACCAGTTC
TTCGTGATAGAGGAGTACACCGGGCCTGACCCCGTGCTTGTGGGCAGGCTTCATTCAGAT
ATTGACTCTGGTGATGGGAACATTAAATACATTCTCTCAGGGGAAGGAGCTGGAACCATT
TTTGTGATTGATGACAAATCAGGGAACATTCATGCCACCAAGACGTTGGATCGAGAAGAG
AGAGCCCAGTACACGTTGATGGCTCAGGCGGTGGACAGGGACACCAATCGGCCACTGGAG
CCACCGTCGGAATTCATTGTCAAGGTCCAGGACATTAATGACAACCCTCCGGAGTTCCTG
CACGAGACCTATCATGCCAACGTGCCTGAGAGGTCCAATGTGGGAACGTCAGTAATCCAG
GTGACAGCTTCAGATGCAGATGACCCCACTTATGGAAATAGCGCCAAGTTAGTGTACAGT
ATCCTCGAAGGACAACCCTATTTTTCGGTGGAAGCACAGACAGGTATCATCAGAACAGCC
CTACCCAACATGGACAGGGAGGCCAAGGAGGAGTACCACGTGGTGATCCAGGCCAAGGAC
ATGGGTGGACATATGGGCGGACTCTCAGGGACAACCAAAGTGACGATCACACTGACCGAT
GTCAATGACAACCCACCAAAGTTTCCGCAGAGCGTATACCAGATGTCTGTGTCAGAAGCA
GCCGTCCCTGGGGAGGAAGTAGGAAGAGTGAAAGCTAAAGATCCAGACATTGGAGAAAAT
GGCTTAGTCACATACAATATTGTTGATGGAGATGGTATGGAATCGTTTGAAATCACAACG
GACTATGAAACACAGGAGGGGGTGATAAAGCTGAAAAAGCCTGTAGATTTTGAAACCAAA
AGAGCCTATAGCTTGAAGGTAGAGGCAGCCAACGTGCACATCGACCCGAAGTTTATCAGC
AATGGCCCTTTCAAGGACACTGTGACCGTCAAGATCTCAGTAGAAGATGCTGATGAGCCC
CCTATGTTCTTGGCCCCAAGTTACATCCACGAAGTCCAAGAAAATGCAGCTGCTGGCACC
GTGGTTGGGAGAGTGCATGCCAAAGACCCTGATGCTGCCAACAGCCCGATAAGGTATTCC
ATCGATCGTCACACTGACCTCGACAGATTTTTCACTATTAATCCAGAGGATGGTTTTATT
AAAACTACAAAACCTCTGGATAGAGAGGAAACAGCCTGGCTCAACATCACTGTCTTTGCA
GCAGAAATCCACAATCGGCATCAGGAAGCCAAAGTCCCAGTGGCCATTAGGGTCCTTGAT
GTCAACGATAATGCTCCCAAGTTTGCTGCCCCTTATGAAGGTTTCATCTGTGAGAGTGAT
CAGACCAAGCCACTTTCCAACCAGCCAATTGTTACAATTAGTGCAGATGACAAGGATGAC
ACGGCCAATGGACCAAGATTTATCTTCAGCCTACCCCCTGAAATCATTCACAATCCAAAT
TTCACAGTCAGAGACAACCGAGATAACACAGCAGGCGTGTACGCCCGGCGTGGAGGGTTC
AGTCGGCAGAAGCAGGACTTGTACCTTCTGCCCATAGTGATCAGCGATGGCGGCATCCCG
CCCATGAGTAGCACCAACACCCTCACCATCAAAGTCTGCGGGTGCGACGTGAACGGGGCA
CTGCTCTCCTGCAACGCAGAGGCCTACATTCTGAACGCCGGCCTGAGCACAGGCGCCCTG
ATCGCCATCCTCGCCTGCATCGTCATTCTCCTGGTCATTGTAGTATTGTTTGTGACCCTG
AGAAGGCAAAAGAAAGAACCACTCATTGTCTTTGAGGAAGAAGATGTCCGTGAGAACATC
ATTACTTATGATGATGAAGGGGGTGGGGAAGAAGACACAGAAGCCTTTGATATTGCCACC
CTCCAGAATCCTGATGGTATCAATGGATTTATCCCCCGCAAAGACATCAAACCTGAGTAT
CAGTACATGCCTAGACCTGGGCTCCGGCCAGCGCCCAACAGCGTGGATGTCGATGACTTC
ATCAACACGAGAATACAGGAGGCAGACAATGACCCCACGGCTCCTCCTTATGACTCCATT
CAAATCTACGGTTATGAAGGCAGGGGCTCAGTGGCCGGGTCCCTGAGCTCCCTAGAGTCG
GCCACCACAGATTCAGACTTGGACTATGATTATCTACAGAACTGGGGACCTCGTTTTAAG
AAACTAGCAGATTTGTATGGTTCCAAAGACACTTTTGATGACGATTCTTAA
Protein Properties
Number of Residues 796
Molecular Weight 87964.5
Theoretical pI 4.51
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 618-640
Protein Sequence
>Cadherin-11
MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLD
VNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDDS
GenBank ID Protein 16306532
UniProtKB/Swiss-Prot ID P55287
UniProtKB/Swiss-Prot Entry Name CAD11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001797.2
GeneCard ID CDH11
GenAtlas ID CDH11
HGNC ID HGNC:1750
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  3. Tanihara H, Sano K, Heimark RL, St John T, Suzuki S: Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin. Cell Adhes Commun. 1994 Apr;2(1):15-26. [PubMed:7982033 ]
  4. Okazaki M, Takeshita S, Kawai S, Kikuno R, Tsujimura A, Kudo A, Amann E: Molecular cloning and characterization of OB-cadherin, a new member of cadherin family expressed in osteoblasts. J Biol Chem. 1994 Apr 22;269(16):12092-8. [PubMed:8163513 ]
  5. Suzuki S, Sano K, Tanihara H: Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue. Cell Regul. 1991 Apr;2(4):261-70. [PubMed:2059658 ]
  6. Oliveira AM, Hsi BL, Weremowicz S, Rosenberg AE, Dal Cin P, Joseph N, Bridge JA, Perez-Atayde AR, Fletcher JA: USP6 (Tre2) fusion oncogenes in aneurysmal bone cyst. Cancer Res. 2004 Mar 15;64(6):1920-3. [PubMed:15026324 ]