Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07507
Secondary Accession Numbers
  • 13215
Name Cadherin-13
Synonyms
  1. H-cadherin
  2. Heart cadherin
  3. P105
  4. T-cad
  5. T-cadherin
  6. Truncated cadherin
Gene Name CDH13
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location Chromosome:1
Locus 16q23.3
SNPs CDH13
Gene Sequence
>2142 bp
ATGCAGCCGAGAACTCCGCTCGTTCTGTGCGTTCTCCTGTCCCAGGTGCTGCTGCTAACA
TCTGCAGAAGATTTGGACTGCACTCCTGGATTTCAGCAGAAAGTGTTCCATATCAATCAG
CCAGCTGAATTCATTGAGGACCAGTCAATTCTAAACTTGACCTTCAGTGACTGTAAGGGA
AACGACAAGCTACGCTATGAGGTCTCGAGCCCATACTTCAAGGTGAACAGCGATGGCGGC
TTAGTTGCTCTGAGAAACATAACTGCAGTGGGCAAAACTCTGTTCGTCCATGCACGGACC
CCCCATGCGGAAGATATGGCAGAACTCGTGATTGTCGGGGGGAAAGACATCCAGGGCTCC
TTGCAGGATATATTTAAATTTGCAAGAACTTCTCCTGTCCCAAGACAAAAGAGGTCCATT
GTGGTATCTCCCATTTTAATTCCAGAGAATCAGAGACAGCCTTTCCCAAGAGATGTTGGC
AAGGTAGTCGATAGTGACAGGCCAGAAAGGTCCAAGTTCCGGCTCACTGGAAAGGGAGTG
GATCAAGAGCCTAAAGGAATTTTCAGAATCAATGAGAACACAGGGAGCGTCTCCGTGACA
CGGACCTTGGACAGAGAAGTAATCGCTGTTTATCAACTATTTGTGGAGACCACTGATGTC
AATGGCAAAACTCTCGAGGGGCCGGTGCCTCTGGAAGTCATTGTGATTGATCAGAATGAC
AACCGACCGATCTTTCGGGAAGGCCCCTACATCGGCCACGTCATGGAAGGGTCACCCACA
GGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCC
CTCCTGCGGTATAATATCCGTCAACAGACGCCTGACAAGCCATCTCCCAACATGTTCTAC
ATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAGAG
ACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGAT
GTTGGATTAACAGGCACGGCCACAGCCACGATCATGATCGATGACAAAAATGATCACTCA
CCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGAGTTATT
GTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTAC
ACCATCATCAACGGAAACCCCGGGCAGAGCTTTGAAATCCACACCAACCCTCAAACCAAC
GAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCCTG
CTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCC
ACAGCCACCGTCCACATCACTGTCCTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGAC
CCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACAGTGAAT
GCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCA
GCAGGTTGGCTGAATATTAACCCCATCAATGGGACTGTTGACACCACAGCTGTGCTGGAC
CGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACAGT
GGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGAC
AATGCCCCGTTCATTTACCCCACAGTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGT
GTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTCAAATTT
GAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACA
CACGCCCTGGTAAGCCTTCTTCAAAATCTGAACAAAGCAAACTACAACCTGCCCATCATG
GTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAAGTGTGC
TCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCGGGGGCCCTGCGCTTCAGCCTGCCC
TCAGTCCTGCTCCTCAGCCTCTTCAGCTTAGCTTGTCTGTGA
Protein Properties
Number of Residues 713
Molecular Weight 78286.2
Theoretical pI 4.57
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Cadherin-13
MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKG
NDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS
LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGV
DQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQND
NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS
PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
PMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLD
RESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
VTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL
GenBank ID Protein 3434957
UniProtKB/Swiss-Prot ID P55290
UniProtKB/Swiss-Prot Entry Name CAD13_HUMAN
PDB IDs Not Available
GenBank Gene ID AB001103
GeneCard ID CDH13
GenAtlas ID CDH13
HGNC ID HGNC:1753
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Elortza F, Mohammed S, Bunkenborg J, Foster LJ, Nuhse TS, Brodbeck U, Peck SC, Jensen ON: Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment. J Proteome Res. 2006 Apr;5(4):935-43. [PubMed:16602701 ]
  5. Tanihara H, Sano K, Heimark RL, St John T, Suzuki S: Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin. Cell Adhes Commun. 1994 Apr;2(1):15-26. [PubMed:7982033 ]
  6. Lee SW: H-cadherin, a novel cadherin with growth inhibitory functions and diminished expression in human breast cancer. Nat Med. 1996 Jul;2(7):776-82. [PubMed:8673923 ]
  7. Sato M, Mori Y, Sakurada A, Fujimura S, Horii A: The H-cadherin (CDH13) gene is inactivated in human lung cancer. Hum Genet. 1998 Jul;103(1):96-101. [PubMed:9737784 ]
  8. Tkachuk VA, Bochkov VN, Philippova MP, Stambolsky DV, Kuzmenko ES, Sidorova MV, Molokoedov AS, Spirov VG, Resink TJ: Identification of an atypical lipoprotein-binding protein from human aortic smooth muscle as T-cadherin. FEBS Lett. 1998 Jan 16;421(3):208-12. [PubMed:9468307 ]
  9. Takeuchi T, Misaki A, Liang SB, Tachibana A, Hayashi N, Sonobe H, Ohtsuki Y: Expression of T-cadherin (CDH13, H-Cadherin) in human brain and its characteristics as a negative growth regulator of epidermal growth factor in neuroblastoma cells. J Neurochem. 2000 Apr;74(4):1489-97. [PubMed:10737605 ]
  10. Niermann T, Kern F, Erne P, Resink T: The glycosyl phosphatidylinositol anchor of human T-cadherin binds lipoproteins. Biochem Biophys Res Commun. 2000 Oct 5;276(3):1240-7. [PubMed:11027617 ]