You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07509
Secondary Accession Numbers
  • 13217
Name Cadherin-17
Synonyms
  1. Intestinal peptide-associated transporter HPT-1
  2. LI-cadherin
  3. Liver-intestine cadherin
Gene Name CDH17
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:8
Locus 8q22.1
SNPs CDH17
Gene Sequence
>2499 bp
ATGATACTTCAGGCCCATCTTCACTCCCTGTGTCTTCTTATGCTTTATTTGGCAACTGGA
TATGGCCAAGAGGGGAAGTTTAGTGGACCCCTGAAACCCATGACATTTTCTATTTATGAA
GGCCAAGAACCGAGTCAAATTATATTCCAGTTTAAGGCCAATCCTCCTGCTGTGACTTTT
GAACTAACTGGGGAGACAGACAACATATTTGTGATAGAACGGGAGGGACTTCTGTATTAC
AACAGAGCCTTGGACAGGGAAACAAGATCTACTCACAATCTCCAGGTTGCAGCCCTGGAC
GCTAATGGAATTATAGTGGAGGGTCCAGTCCCTATCACCATAAAAGTGAAGGACATCAAC
GACAATCGACCCACGTTTCTCCAGTCAAAGTACGAAGGCTCAGTAAGGCAGAACTCTCGC
CCAGGAAAGCCCTTCTTGTATGTCAATGCCACAGACCTGGATGATCCGGCCACTCCCAAT
GGCCAGCTTTATTACCAGATTGTCATCCAGCTTCCCATGATCAACAATGTCATGTACTTT
CAGATCAACAACAAAACGGGAGCCATCTCTCTTACCCGAGAGGGATCTCAGGAATTGAAT
CCTGCTAAGAATCCTTCCTATAATCTGGTGATCTCAGTGAAGGACATGGGAGGCCAGAGT
GAGAATTCCTTCAGTGATACCACATCTGTGGATATCATAGTGACAGAGAATATTTGGAAA
GCACCAAAACCTGTGGAGATGGTGGAAAACTCAACTGATCCTCACCCCATCAAAATCACT
CAGGTGCGGTGGAATGATCCCGGTGCACAATATTCCTTAGTTGACAAAGAGAAGCTGCCA
AGATTCCCATTTTCAATTGACCAGGAAGGAGATATTTACGTGACTCAGCCCTTGGACCGA
GAAGAAAAGGATGCATATGTTTTTTATGCAGTTGCAAAGGATGAGTACGGAAAACCACTT
TCATATCCGCTGGAAATTCATGTAAAAGTTAAAGATATTAATGATAATCCACCTACATGT
CCGTCACCAGTAACCGTATTTGAGGTCCAGGAGAATGAACGACTGGGTAACAGTATCGGG
ACCCTTACTGCACATGACAGGGATGAAGAAAATACTGCCAACAGTTTTCTAAACTACAGG
ATTGTGGAGCAAACTCCCAAACTTCCCATGGATGGACTCTTCCTAATCCAAACCTATGCT
GGAATGTTACAGTTAGCTAAACAGTCCTTGAAGAAGCAAGATACTCCTCAGTACAACTTA
ACGATAGAGGTGTCTGACAAAGATTTCAAGACCCTTTGTTTTGTGCAAATCAACGTTATT
GATATCAATGATCAGATCCCCATCTTTGAAAAATCAGATTATGGAAACCTGACTCTTGCT
GAAGACACAAACATTGGGTCCACCATCTTAACCATCCAGGCCACTGATGCTGATGAGCCA
TTTACTGGGAGTTCTAAAATTCTGTATCATATCATAAAGGGAGACAGTGAGGGACGCCTG
GGGGTTGACACAGATCCCCATACCAACACCGGATATGTCATAATTAAAAAGCCTCTTGAT
TTTGAAACAGCAGCTGTTTCCAACATTGTGTTCAAAGCAGAAAATCCTGAGCCTCTAGTG
TTTGGTGTGAAGTACAATGCAAGTTCTTTTGCCAAGTTCACGCTTATTGTGACAGATGTG
AATGAAGCACCTCAATTTTCCCAACACGTATTCCAAGCGAAAGTCAGTGAGGATGTAGCT
ATAGGCACTAAAGTGGGCAATGTGACTGCCAAGGATCCAGAAGGTCTGGACATAAGCTAT
TCACTGAGGGGAGACACAAGAGGTTGGCTTAAAATTGACCACGTGACTGGTGAGATCTTT
AGTGTGGCTCCATTGGACAGAGAAGCCGGAAGTCCATATCGGGTACAAGTGGTGGCCACA
GAAGTAGGGGGGTCTTCCTTGAGCTCTGTGTCAGAGTTCCACCTGATCCTTATGGATGTG
AATGACAACCCTCCCAGGCTAGCCAAGGACTACACGGGCTTGTTCTTCTGCCATCCCCTC
AGTGCACCTGGAAGTCTCATTTTCGAGGCTACTGATGATGATCAGCACTTATTTCGGGGT
CCCCATTTTACATTTTCCCTCGGCAGTGGAAGCTTACAAAACGACTGGGAAGTTTCCAAA
ATCAATGGTACTCATGCCCGACTGTCTACCAGGCACACAGAGTTTGAGGAGAGGGAGTAT
GTCGTCTTGATCCGCATCAATGATGGGGGTCGGCCACCCTTGGAAGGCATTGTTTCTTTA
CCAGTTACATTCTGCAGTTGTGTGGAAGGAAGTTGTTTCCGGCCAGCAGGTCACCAGACT
GGGATACCCACTGTGGGCATGGCAGTTGGTATACTGCTGACCACCCTTCTGGTGATTGGT
ATAATTTTAGCAGTTGTGTTTATCCGCATAAAGAAGGATAAAGGCAAAGATAATGTTGAA
AGTGCTCAAGCATCTGAAGTCAAACCTCTGAGAAGCTGA
Protein Properties
Number of Residues 832
Molecular Weight 92218.6
Theoretical pI 4.75
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 788-808
Protein Sequence
>Cadherin-17
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS
GenBank ID Protein 221316595
UniProtKB/Swiss-Prot ID Q12864
UniProtKB/Swiss-Prot Entry Name CAD17_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001144663.1
GeneCard ID CDH17
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  4. Dantzig AH, Hoskins JA, Tabas LB, Bright S, Shepard RL, Jenkins IL, Duckworth DC, Sportsman JR, Mackensen D, Rosteck PR Jr, et al.: Association of intestinal peptide transport with a protein related to the cadherin superfamily. Science. 1994 Apr 15;264(5157):430-3. [PubMed:8153632 ]