You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07518
Secondary Accession Numbers
  • 13226
Name Cadherin-2
Synonyms
  1. CD325 antigen
  2. CDw325
  3. N-cadherin
  4. Neural cadherin
Gene Name CDH2
Protein Type Unknown
Biological Properties
General Function Involved in alpha-catenin binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH2 may be involved in neuronal recognition mechanism
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 18q11.2
SNPs CDH2
Gene Sequence
>2721 bp
ATGTGCCGGATAGCGGGAGCGCTGCGGACCCTGCTGCCGCTGCTGGCGGCCCTGCTTCAG
GCGTCTGTAGAGGCTTCTGGTGAAATCGCATTATGCAAGACTGGATTTCCTGAAGATGTT
TACAGTGCAGTCTTATCGAAGGATGTGCATGAAGGACAGCCTCTTCTCAATGTGAAGTTT
AGCAACTGCAATGGAAAAAGAAAAGTACAATATGAGAGCAGTGAGCCTGCAGATTTTAAG
GTGGATGAAGATGGCATGGTGTATGCCGTGAGAAGCTTTCCACTCTCTTCTGAACATGCC
AAGTTCCTGATATATGCCCAAGACAAAGAGACCCAGGAAAAGTGGCAAGTGGCAGTAAAA
TTGAGCCTGAAGCCAACCTTAACTGAGGAGTCAGTGAAGGAGTCAGCAGAAGTTGAAGAA
ATAGTGTTCCCAAGACAATTCAGTAAGCACAGTGGCCACCTACAAAGGCAGAAGAGAGAC
TGGGTCATCTCTCCAATCAACTTGCCAGAAAACTCCAGGGGACCTTTTCCTCAAGAGCTT
GTCAGGATCAGGTCTGATAGAGATAAAAACCTTTCACTGCGGTACAGTGTAACTGGGCCA
GGAGCTGACCAGCCTCCAACTGGTATCTTCATTATCAACCCCATCTCGGGTCAGCTGTCG
GTGACAAAGCCCCTGGATCGCGAGCAGATAGCCCGGTTTCATTTGAGGGCACATGCAGTA
GATATTAATGGAAATCAAGTGGAGAACCCCATTGACATTGTCATCAATGTTATTGACATG
AATGACAACAGACCTGAGTTCTTACACCAGGTTTGGAATGGGACAGTTCCTGAGGGATCA
AAGCCTGGAACATATGTGATGACCGTAACAGCAATTGATGCTGACGATCCCAATGCCCTC
AATGGGATGTTGAGGTACAGAATCGTGTCTCAGGCTCCAAGCACCCCTTCACCCAACATG
TTTACAATCAACAATGAGACTGGTGACATCATCACAGTGGCAGCTGGACTTGATCGAGAA
AAAGTGCAACAGTATACGTTAATAATTCAAGCTACAGACATGGAAGGCAATCCCACATAT
GGCCTTTCAAACACAGCCACGGCCGTCATCACAGTGACAGATGTCAATGACAATCCTCCA
GAGTTTACTGCCATGACGTTTTATGGTGAAGTTCCTGAGAACAGGGTAGACATCATAGTA
GCTAATCTAACTGTGACCGATAAGGATCAACCCCATACACCAGCCTGGAACGCAGTGTAC
AGAATCAGTGGCGGAGATCCTACTGGACGGTTCGCCATCCAGACCGACCAAAACAGCAAC
GACGGGTTAGTCACCGTGGTCAAACCAATCGACTTTGAAGCAAATAGGATGTTTGTCCTT
ACTGTTGCTGCAGAAAATCAAGTGCCATTAGCCAAGGGAATTCAGCACCCGCCTCAGTCA
ACTGCAACCATGTCTGTTACAGTTATTGACGTAAATGAAAACCCTTATTTTGCCCCCAAT
CCTAAGATCATTCGCCAAGAAGAAGGGCTTCATGCCGGTACCATGTTGACAACATTCACT
GCTCAGGACCCAGATCGATATATGCAGCAAAATATTAGATACACTAAATTATCTGATCCT
GCCAATTGGCTAAAAATAGATCCTGTGAATGGACAAATAACTACAATTGCTGTTTTGGAC
CGAGAATCACCAAATGTGAAAAACAATATATATAATGCTACTTTCCTTGCTTCTGACAAT
GGAATTCCTCCTATGAGTGGAACAGGAACGCTGCAGATCTATTTACTTGATATTAATGAC
AATGCCCCTCAAGTGTTACCTCAAGAGGCAGAGACTTGCGAAACTCCAGACCCCAATTCA
ATTAATATTACAGCACTTGATTATGGCATTGATCCAAATGCTGGACCATTTGCTTTTGAT
CTTCCTTTATCTCCAGTGACTATTAAGAGAAATTGGACCATCACTCGGCTTAATGGTGAT
TTTGCTCAGCTTAATTTAAAGATAAAATTTCTTGAAGCTGGTATCTATGAAGTTCCCATC
ATAATCACAGATTCGGGTAATCCTCCCAAATCAAATATTTCCATACTGCGCGTGAAGGTT
TGCCAGTGTGACTCCAACGGGGACTGCACAGATGTGGACAGGATTGTGGGTGCGGGGCTT
GGCACCGGTGCCATCATTGCCATCCTGCTCTGCATCATCATCCTGCTTATCCTTGTGCTG
ATGTTTGTGGTATGGATGAAACGCCGGGATAAAGAACGCCAGGCCAAACAACTTTTAATT
GATCCAGAAGATGATGTAAGAGATAATATTTTAAAATATGATGAAGAAGGTGGAGGAGAA
GAAGACCAGGACTATGACTTGAGCCAGCTGCAGCAGCCTGACACTGTGGAGCCTGATGCC
ATCAAGCCTGTGGGAATCCGACGAATGGATGAAAGACCCATCCACGCTGAGCCCCAGTAT
CCGGTCCGATCTGCAGCCCCACACCCTGGAGACATTGGGGACTTCATTAATGAGGGCCTT
AAAGCGGCTGACAATGACCCCACAGCTCCACCATATGACTCCCTGTTAGTGTTTGACTAT
GAAGGCAGTGGCTCCACTGCTGGGTCCTTGAGCTCCCTTAATTCCTCAAGTAGTGGTGGT
GAGCAGGACTATGATTACCTGAACGACTGGGGGCCACGGTTCAAGAAACTTGCTGACATG
TATGGTGGAGGTGATGACTGA
Protein Properties
Number of Residues 906
Molecular Weight 99808.4
Theoretical pI 4.4
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • 725-745
Protein Sequence
>Cadherin-2
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
GenBank ID Protein 22209070
UniProtKB/Swiss-Prot ID P19022
UniProtKB/Swiss-Prot Entry Name CADH2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC036470
GeneCard ID CDH2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Amanchy R, Kalume DE, Iwahori A, Zhong J, Pandey A: Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC). J Proteome Res. 2005 Sep-Oct;4(5):1661-71. [PubMed:16212419 ]
  4. Bhatt AS, Erdjument-Bromage H, Tempst P, Craik CS, Moasser MM: Adhesion signaling by a novel mitotic substrate of src kinases. Oncogene. 2005 Aug 11;24(34):5333-43. [PubMed:16007225 ]
  5. Reid RA, Hemperly JJ: Human N-cadherin: nucleotide and deduced amino acid sequence. Nucleic Acids Res. 1990 Oct 11;18(19):5896. [PubMed:2216790 ]
  6. Salomon D, Ayalon O, Patel-King R, Hynes RO, Geiger B: Extrajunctional distribution of N-cadherin in cultured human endothelial cells. J Cell Sci. 1992 May;102 ( Pt 1):7-17. [PubMed:1500442 ]
  7. Walsh FS, Barton CH, Putt W, Moore SE, Kelsell D, Spurr N, Goodfellow PN: N-cadherin gene maps to human chromosome 18 and is not linked to the E-cadherin gene. J Neurochem. 1990 Sep;55(3):805-12. [PubMed:2384753 ]
  8. Wallis J, Fox MF, Walsh FS: Structure of the human N-cadherin gene: YAC analysis and fine chromosomal mapping to 18q11.2. Genomics. 1994 Jul 1;22(1):172-9. [PubMed:7959764 ]