You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07521
Secondary Accession Numbers
  • 13229
Name Cadherin-5
Synonyms
  1. 7B4 antigen
  2. CD144 antigen
  3. VE-cadherin
  4. Vascular endothelial cadherin
Gene Name CDH5
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Cell junction
  3. Single-pass type I membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs CDH5
Gene Sequence
>2355 bp
ATGCAGAGGCTCATGATGCTCCTCGCCACATCGGGCGCCTGCCTGGGCCTGCTGGCAGTG
GCAGCAGTGGCAGCAGCAGGTGCTAACCCTGCCCAACGGGACACCCACAGCCTGCTGCCC
ACCCACCGGCGCCAAAAGAGAGATTGGATTTGGAACCAGATGCACATTGATGAAGAGAAA
AACACCTCACTTCCCCATCATGTAGGCAAGATCAAGTCAAGCGTGAGTCGCAAGAATGCC
AAGTACCTGCTCAAAGGAGAATATGTGGGCAAGGTCTTCCGGGTCGATGCAGAGACAGGA
GACGTGTTCGCCATTGAGAGGCTGGACCGGGAGAATATCTCAGAGTACCACCTCACTGCT
GTCATTGTGGACAAGGACACTGGTGAAAACCTGGAGACTCCTTCCAGCTTCACCATCAAA
GTTCATGACGTGAACGACAACTGGCCTGTGTTCACGCATCGGTTGTTCAATGCGTCCGTG
CCTGAGTCGTCGGCTGTGGGGACCTCAGTCATCTCTGTGACAGCAGTGGATGCAGACGAC
CCCACTGTGGGAGACCACGCCTCTGTCATGTACCAAATCCTGAAGGGGAAAGAGTATTTT
GCCATCGATAATTCTGGACGTATTATCACAATAACGAAAAGCTTGGACCGAGAGAAGCAG
GCCAGGTATGAGATCGTGGTGGAAGCGCGAGATGCCCAGGGCCTCCGGGGGGACTCGGGC
ACGGCCACCGTGCTGGTCACTCTGCAAGACATCAATGACAACTTCCCCTTCTTCACCCAG
ACCAAGTACACATTTGTCGTGCCTGAAGACACCCGTGTGGGCACCTCTGTGGGCTCTCTG
TTTGTTGAGGACCCAGATGAGCCCCAGAACCGGATGACCAAGTACAGCATCTTGCGGGGC
GACTACCAGGACGCTTTCACCATTGAGACAAACCCCGCCCACAACGAGGGCATCATCAAG
CCCATGAAGCCTCTGGATTATGAATACATCCAGCAATACAGCTTCATCGTCGAGGCCACA
GACCCCACCATCGACCTCCGATACATGAGCCCTCCCGCGGGAAACAGAGCCCAGGTCATT
ATCAACATCACAGATGTGGACGAGCCCCCCATTTTCCAGCAGCCTTTCTACCACTTCCAG
CTGAAGGAAAACCAGAAGAAGCCTCTGATTGGCACAGTGCTGGCCATGGACCCTGATGCG
GCTAGGCATAGCATTGGATACTCCATCCGCAGGACCAGTGACAAGGGCCAGTTCTTCCGA
GTCACAAAAAAGGGGGACATTTACAATGAGAAAGAACTGGACAGAGAAGTCTACCCCTGG
TATAACCTGACTGTGGAGGCCAAAGAACTGGATTCCACTGGAACCCCCACAGGAAAAGAA
TCCATTGTGCAAGTCCACATTGAAGTTTTGGATGAGAATGACAATGCCCCGGAGTTTGCC
AAGCCCTACCAGCCCAAAGTGTGTGAGAACGCTGTCCATGGCCAGCTGGTCCTGCAGATC
TCCGCAATAGACAAGGACATAACACCACGAAACGTGAAGTTCAAATTCACCTTGAATACT
GAGAACAACTTTACCCTCACGGATAATCACGATAACACGGCCAACATCACAGTCAAGTAT
GGGCAGTTTGACCGGGAGCATACCAAGGTCCACTTCCTACCCGTGGTCATCTCAGACAAT
GGGATGCCAAGTCGCACGGGCACCAGCACGCTGACCGTGGCCGTGTGCAAGTGCAACGAG
CAGGGCGAGTTCACCTTCTGCGAGGATATGGCCGCCCAGGTGGGCGTGAGCATCCAGGCA
GTGGTAGCCATCTTACTCTGCATCCTCACCATCACAGTGATCACCCTGCTCATCTTCCTG
CGGCGGCGGCTCCGGAAGCAGGCCCGCGCGCACGGCAAGAGCGTGCCGGAGATCCACGAG
CAGCTGGTCACCTACGACGAGGAGGGCGGCGGCGAGATGGACACCACCAGCTACGATGTG
TCGGTGCTCAACTCGGTGCGCCGCGGCGGGGCCAAGCCCCCGCGGCCCGCGCTGGACGCC
CGGCCTTCCCTCTATGCGCAGGTGCAGAAGCCACCGAGGCACGCGCCTGGGGCACACGGA
GGGCCCGGGGAGATGGCAGCCATGATCGAGGTGAAGAAGGACGAGGCGGACCACGACGGC
GACGGCCCCCCCTACGACACGCTGCACATCTACGGCTACGAGGGCTCCGAGTCCATAGCC
GAGTCCCTCAGCTCCCTGGGCACCGACTCATCCGACTCTGACGTGGATTACGACTTCCTT
AACGACTGGGGACCCAGGTTTAAGATGCTGGCTGAGCTGTACGGCTCGGACCCCCGGGAG
GAGCTGCTGTATTAG
Protein Properties
Number of Residues 784
Molecular Weight 87515.7
Theoretical pI 5.07
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • 600-620
Protein Sequence
>Cadherin-5
MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFTLNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY
GenBank ID Protein 599834
UniProtKB/Swiss-Prot ID P33151
UniProtKB/Swiss-Prot Entry Name CADH5_HUMAN
PDB IDs Not Available
GenBank Gene ID X79981
GeneCard ID CDH5
GenAtlas ID CDH5
HGNC ID HGNC:1764
References
General References
  1. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  2. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  3. Graziani A, Poteser M, Heupel WM, Schleifer H, Krenn M, Drenckhahn D, Romanin C, Baumgartner W, Groschner K: Cell-cell contact formation governs Ca2+ signaling by TRPC4 in the vascular endothelium: evidence for a regulatory TRPC4-beta-catenin interaction. J Biol Chem. 2010 Feb 5;285(6):4213-23. doi: 10.1074/jbc.M109.060301. Epub 2009 Dec 8. [PubMed:19996314 ]
  4. Shimoyama Y, Tsujimoto G, Kitajima M, Natori M: Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins. Biochem J. 2000 Jul 1;349(Pt 1):159-67. [PubMed:10861224 ]
  5. Suzuki S, Sano K, Tanihara H: Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue. Cell Regul. 1991 Apr;2(4):261-70. [PubMed:2059658 ]
  6. Breviario F, Caveda L, Corada M, Martin-Padura I, Navarro P, Golay J, Introna M, Gulino D, Lampugnani MG, Dejana E: Functional properties of human vascular endothelial cadherin (7B4/cadherin-5), an endothelium-specific cadherin. Arterioscler Thromb Vasc Biol. 1995 Aug;15(8):1229-39. [PubMed:7627717 ]
  7. Ali J, Liao F, Martens E, Muller WA: Vascular endothelial cadherin (VE-cadherin): cloning and role in endothelial cell-cell adhesion. Microcirculation. 1997 Jun;4(2):267-77. [PubMed:9219219 ]
  8. Lampugnani MG, Resnati M, Raiteri M, Pigott R, Pisacane A, Houen G, Ruco LP, Dejana E: A novel endothelial-specific membrane protein is a marker of cell-cell contacts. J Cell Biol. 1992 Sep;118(6):1511-22. [PubMed:1522121 ]