You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07522
Secondary Accession Numbers
  • 13230
Name Cadherin-6
Synonyms
  1. K-cadherin
  2. Kidney cadherin
Gene Name CDH6
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5p13.3
SNPs CDH6
Gene Sequence
>2373 bp
ATGAGAACTTACCGCTACTTCTTGCTGCTCTTTTGGGTGGGCCAGCCCTACCCAACTCTC
TCAACTCCACTATCAAAGAGGACTAGTGGTTTCCCAGCAAAGAAAAGGGCCCTGGAGCTC
TCTGGAAACAGCAAAAATGAGCTGAACCGTTCAAAAAGGAGCTGGATGTGGAATCAGTTC
TTTCTCCTGGAGGAATACACAGGATCCGATTATCAGTATGTGGGCAAGTTACATTCAGAC
CAGGATAGAGGAGATGGATCACTTAAATATATCCTTTCAGGAGATGGAGCAGGAGATCTC
TTCATTATTAATGAAAACACAGGCGACATACAGGCCACCAAGAGGCTGGACAGGGAAGAA
AAACCCGTTTACATCCTTCGAGCTCAAGCTATAAACAGAAGGACAGGGAGACCCGTGGAG
CCCGAGTCTGAATTCATCATCAAGATCCATGACATCAATGACAATGAACCAATATTCACC
AAGGAGGTTTACACAGCCACTGTCCCTGAAATGTCTGATGTCGGTACATTTGTTGTCCAA
GTCACTGCGACGGATGCAGATGATCCAACATATGGGAACAGTGCTAAAGTTGTCTACAGT
ATTCTACAGGGACAGCCCTATTTTTCAGTTGAATCAGAAACAGGTATTATCAAGACAGCT
TTGCTCAACATGGATCGAGAAAACAGGGAGCAGTACCAAGTGGTGATTCAAGCCAAGGAT
ATGGGCGGCCAGATGGGAGGATTATCTGGGACCACCACCGTGAACATCACACTGACTGAT
GTCAACGACAACCCTCCCCGATTCCCCCAGAGTACATACCAGTTTAAAACTCCTGAATCT
TCTCCACCGGGGACACCAATTGGCAGAATCAAAGCCAGCGATGCTGATGTGGGAGAAAAT
GCTGAAATTGAGTACAGCATCACAGACGGTGAGGGGCTGGATATGTTTGATGTCATCACC
GACCAGGAAACCCAGGAAGGGATTATAACTGTCAAAAAGCTCTTGGACTTTGAAAAGAAG
AAAGTGTATACCCTTAAAGTGGAAGCCTCCAATCCTTATGTTGAGCCACGATTTCTCTAC
TTGGGGCCTTTCAAAGATTCAGCCACGGTTAGAATTGTGGTGGAGGATGTAGATGAGCCA
CCTGTCTTCAGCAAACTGGCCTACATCTTACAAATAAGAGAAGATGCTCAGATAAACACC
ACAATAGGCTCCGTCACAGCCCAAGATCCAGATGCTGCCAGGAATCCTGTCAAGTACTCT
GTAGATCGACACACAGATATGGACAGAATATTCAACATTGATTCTGGAAATGGTTCGATT
TTTACATCGAAACTTCTTGACCGAGAAACACTGCTATGGCACAACATTACAGTGATAGCA
ACAGAGATCAATAATCCAAAGCAAAGTAGTCGAGTACCTCTATATATTAAAGTTCTAGAT
GTCAATGACAACGCCCCAGAATTTGCTGAGTTCTATGAAACTTTTGTCTGTGAAAAAGCA
AAGGCAGATCAGTTGATTCAGACCTTGCATGCTGTTGACAAGGATGACCCTTATAGTGGG
CACCAATTTTCGTTTTCCTTGGCCCCTGAAGCAGCCAGTGGCTCAAACTTTACCATTCAA
GACAACAAAGACAACACGGCGGGAATCTTAACTCGGAAAAATGGCTATAATAGACACGAG
ATGAGCACCTATCTCTTGCCTGTGGTCATTTCAGACAACGACTACCCAGTTCAAAGCAGC
ACTGGGACAGTGACTGTCCGGGTCTGTGCATGTGACCACCACGGGAACATGCAATCCTGC
CACGCGGAGGCGCTCATCCACCCCACGGGACTGAGCACGGGGGCTCTGGTTGCCATCCTT
CTGTGCATCGTGATCCTACTAGTGACAGTGGTGCTGTTTGCAGCTCTGAGGCGGCAGCGA
AAAAAAGAGCCTTTGATCATTTCCAAAGAGGACATCAGAGATAACATTGTCAGTTACAAC
GACGAAGGTGGTGGAGAGGAGGACACCCAGGCTTTTGATATCGGCACCCTGAGGAATCCT
GAAGCCATAGAGGACAACAAATTACGAAGGGACATTGTGCCCGAAGCCCTTTTCCTACCC
CGACGGACTCCAACAGCTCGCGACAACACCGATGTCAGAGATTTCATTAACCAAAGGTTA
AAGGAAAATGACACGGACCCCACTGCCCCGCCATACGACTCCTTGGCCACTTACGCCTAT
GAAGGCACTGGCTCCGTGGCGGATTCCCTGAGCTCGCTGGAGTCAGTGACCACGGATGCA
GATCAAGACTATGATTACCTTAGTGACTGGGGACCTCGATTCAAAAAGCTTGCAGATATG
TATGGAGGAGTGGACAGTGACAAAGACTCCTAA
Protein Properties
Number of Residues 790
Molecular Weight 88307.8
Theoretical pI 4.53
Pfam Domain Function
Signals
  • 1-18
Transmembrane Regions
  • 616-636
Protein Sequence
>Cadherin-6
MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQF
FLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREE
KPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQ
VTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPGTPIGRIKASDADVGEN
AEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLY
LGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYS
VDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLD
VNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQ
DNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSC
HAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYN
DEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRL
KENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADM
YGGVDSDKDS
GenBank ID Protein 158256016
UniProtKB/Swiss-Prot ID P55285
UniProtKB/Swiss-Prot Entry Name CADH6_HUMAN
PDB IDs Not Available
GenBank Gene ID AK291290
GeneCard ID CDH6
GenAtlas ID CDH6
HGNC ID HGNC:1765
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Cao J, Shen C, Wang H, Shen H, Chen Y, Nie A, Yan G, Lu H, Liu Y, Yang P: Identification of N-glycosylation sites on secreted proteins of human hepatocellular carcinoma cells with a complementary proteomics approach. J Proteome Res. 2009 Feb;8(2):662-72. doi: 10.1021/pr800826u. [PubMed:19196183 ]
  5. Suzuki S, Sano K, Tanihara H: Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue. Cell Regul. 1991 Apr;2(4):261-70. [PubMed:2059658 ]
  6. Shimoyama Y, Gotoh M, Terasaki T, Kitajima M, Hirohashi S: Isolation and sequence analysis of human cadherin-6 complementary DNA for the full coding sequence and its expression in human carcinoma cells. Cancer Res. 1995 May 15;55(10):2206-11. [PubMed:7743525 ]