Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07525
Secondary Accession Numbers
  • 13233
Name Cadherin-9
Synonyms Not Available
Gene Name CDH9
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:5
Locus 5p14
SNPs CDH9
Gene Sequence
>2370 bp
ATGAGGACTTACCATTATATACCATTATTCATCTGGACCTATATGTTCCATATAGTTGAC
ACCATCCTATTACAAGAAAAACCTAACAGTTATTTATCAAGCAAAAAGATAGCGGGTCTG
ACAAAAGATGACGGTAAAATGCTACGTCGCACCAAGCGTGGCTGGATGTGGAATCAGTTC
TTCTTATTGGAAGAGTACACAGGTACTGACACACAATATGTAGGCAAGCTTCACACTGAC
CAAGATAAAGGAGATGGAAATTTAAAATACATACTAACAGGAGATGGGGCTGGCAGTCTA
TTTGTTATAGATGAAAATACAGGAGACATTCATGCTGCAAAGAAACTAGACAGAGAAGAA
AAATCTCTGTACATTCTTCGTGCCAAGGCTATAGACAGAAAAACTGGGCGGCAGGTGGAA
CCGGAATCGGAATTTATCATTAAAATACATGATATCAATGACAATGAGCCAAAATTTACA
AAAGACTTATACACTGCCAGTGTTCCTGAAATGTCTGGAGTCGGTACATCTGTTATACAA
GTAACTGCAACAGATGCAGATGACGCCAACTATGGAAATAGTGCCAAAGTGGTCTATAGC
ATATTGCAAGGACAGCCATATTTTTCAGTGGACCCAGAATCAGGCATAATAAAAACTGCA
TTACCAGACATGAGCAGAGAAAATAGAGAGCAGTACCAGGTTGTTATACAGGCCAAAGAC
ATGGGTGGCCAGATGGGAGGCCTTTCTGGAACCACCACAGTGAACATCACGCTGACAGAT
GTCAACAACAACCCTCCTCGATTTCCCCAGAGTACGTATCAATTTAATTCTCCTGAGTCT
GTACCTCTTGGAACTCATCTTGGAAGGATAAAAGCCAATGACCCTGACGTGGGGGAAAAT
GCAGAAATGGAGTATAGCATTGCTGAAGGAGATGGTGCAGACATGTTCGATGTCATCACT
GACAAGGATACACAGGAAGGGATTATAACTGTCAAACAGAATTTAGATTTTGAAAATCAA
ATGCTCTATACTTTAAGAGTGGATGCAAGTAACACTCACCCTGATCCACGATTCTTACAC
CTGGGACCTTTCAAAGATACAGCTGTGGTCAAAATATCTGTGGAAGATATAGATGAGCCT
CCTGTGTTCACTAAAGTCTCTTACTTGATAGAAGTAGATGAAGATGTAAAGGAGGGCAGT
ATCATTGGACAGGTTACAGCATACGATCCAGATGCCAGGAACAATTTAATAAAGTACTCT
GTTGATCGGCATACTGATATGGACCGTATTTTTGGTATTCACTCAGAAAATGGTTCTATT
TTCACTTTGAAAGCCCTTGACCGGGAATCATCTCCTTGGCATAACATCACTGTTACAGCC
ACAGAAATAAATAACCCAAAACAAAGTAGCCACATCCCTGTCTTCATCAGAATTCTAGAT
ATAAATGACCATGCTCCGGAATTTGCCATGTATTATGAAACATTTGTTTGTGAAAATGCA
AAACCTGGGCAGTTGATTCAGACTGTCAGTGTCATGGATAAGGATGACCCTCCCCGAGGT
CACAAATTCTTTTTTGAACCAGTGCCAGAATTTACTCTCAATCCGAATTTCACCATTGTA
GATAATAAAGATAATACAGCAGGAATCATGACTCGGAAAGATGGCTACAGTCGCAACAAA
ATGAGCACCTACTTATTGCCGATTTTAATCTTTGACAACGATTATCCAATTCAAAGCAGC
ACTGGTACACTCACTATCCGTGTGTGTGCCTGCGATAATCAAGGAAACATGCAATCCTGC
ACCGCAGAAGCCCTGATCCTTTCAGCCGGCCTGAGCACGGGAGCTCTCGTTGCGATTCTA
CTCTGTGTCCTCATACTGCTTATTTTAGTCGTGTTGTTTGCTGCATTGAAGAGGCAAAGA
AAAAAGGAACCTCTGATAATTTCAAAAGACGATGTCCGGGACAACATTGTGACCTACAAC
GATGAAGGCGGCGGGGAAGAAGATACCCAAGCTTTTGACATTGGCACATTAAGGAATCCA
GAGGCAAGAGAAGACAGTAAACTTAGACGGGATGTAATGCCTGAAACTATTTTTCAGATA
AGGAGGACTGTGCCTCTGTGGGAAAATATTGATGTACAAGATTTTATCCATCGAAGATTA
AAAGAAAACGACGCAGACCCAAGTGCACCTCCATATGATTCGCTGGCAACGTATGCCTAT
GAAGGGAATGATTCCATAGCAGATTCGCTCAGTTCTTTGGAATCTCTCACAGCTGATTGT
AACCAAGATTATGATTACCTCAGTGACTGGGGGCCTCGTTTCAAAAAACTTGCCGATATG
TATGGGGGTGATGATAGTGACCGAGACTAA
Protein Properties
Number of Residues 789
Molecular Weight 88688.6
Theoretical pI 4.49
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • 616-636
Protein Sequence
>Cadherin-9
MRTYHYIPLFIWTYMFHTVDTILLQEKPNSYLSSKKIAGLTKDDGKMLRRTKRGWMWNQF
FLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREE
KSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQ
VTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGEN
AEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLH
LGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILD
INDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIV
DNKDNTAGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSC
TAEALILSAGLSTGALVAILLCVLILLILVVLFAALKRQRKKEPLIISKDDVRDNIVTYN
DEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQIRRTVPLWENIDVQDFIHRRL
KENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDWGPRFKKLADM
YGGDDSDRD
GenBank ID Protein 6483296
UniProtKB/Swiss-Prot ID Q9ULB4
UniProtKB/Swiss-Prot Entry Name CADH9_HUMAN
PDB IDs Not Available
GenBank Gene ID AB035302
GeneCard ID CDH9
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Shimoyama Y, Tsujimoto G, Kitajima M, Natori M: Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins. Biochem J. 2000 Jul 1;349(Pt 1):159-67. [PubMed:10861224 ]