Hmdb loader

Showing Protein Calcitonin (HMDBP07530)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP07530
Secondary Accession Numbers
  • 13238
Name Calcitonin
Synonyms
  1. CCP
  2. Calcitonin
  3. Calcitonin carboxyl-terminal peptide
  4. Katacalcin
  5. PDN-21
Gene Name CALCA
Protein Type Unknown
Biological Properties
General Function Involved in hormone activity
Specific Function Katacalcin is a potent plasma calcium-lowering peptide
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
binding
protein binding
receptor binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.2
SNPs CALCA
Gene Sequence 
>426 bp
ATGGGCTTCCAAAAGTTCTCCCCCTTCCTGGCTCTCAGCATCTTGGTCCTGTTGCAGGCA
GGCAGCCTCCATGCAGCACCATTCAGGTCTGCCCTGGAGAGCAGCCCAGCAGACCCGGCC
ACGCTCAGTGAGGACGAAGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAG
ATGAAGGCCAGTGAGCTGGAGCAGGAGCAAGAGAGAGAGGGCTCCAGCCTGGACAGCCCC
AGATCTAAGCGGTGCGGTAATCTGAGTACTTGCATGCTGGGCACATACACGCAGGACTTC
AACAAGTTTCACACGTTCCCCCAAACTGCAATTGGGGTTGGAGCACCTGGAAAGAAAAGG
GATATGTCCAGCGACTTGGAGAGAGACCATCGCCCTCATGTTAGCATGCCCCAGAATGCC
AACTAA
Protein Properties
Number of Residues 141
Molecular Weight 15467.3
Theoretical pI 6.1
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • None
Protein Sequence 
>Calcitonin
MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR
DMSSDLERDHRPHVSMPQNAN
GenBank ID Protein 76880484
UniProtKB/Swiss-Prot ID P01258
UniProtKB/Swiss-Prot Entry Name CALC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001033952.2
GeneCard ID CALCA
GenAtlas ID CALCA
HGNC ID HGNC:1437
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  4. Jonas V, Lin CR, Kawashima E, Semon D, Swanson LW, Mermod JJ, Evans RM, Rosenfeld MG: Alternative RNA processing events in human calcitonin/calcitonin gene-related peptide gene expression. Proc Natl Acad Sci U S A. 1985 Apr;82(7):1994-8. [PubMed:3872459 ]
  5. Nelkin BD, Rosenfeld KI, de Bustros A, Leong SS, Roos BA, Baylin SB: Structure and expression of a gene encoding human calcitonin and calcitonin gene related peptide. Biochem Biophys Res Commun. 1984 Sep 17;123(2):648-55. [PubMed:6148938 ]
  6. Edbrooke MR, Parker D, McVey JH, Riley JH, Sorenson GD, Pettengill OS, Craig RK: Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 1985 Mar;4(3):715-24. [PubMed:2408883 ]
  7. Craig RK, Riley JH, Edbrooke MR, Broad PM, Foord SM, Al-Kazwini SJ, Holman JJ, Marshall I: Expression and function of the human calcitonin/alpha-CGRP gene in health and disease. Biochem Soc Symp. 1986;52:91-105. [PubMed:3034287 ]
  8. Le Moullec JM, Jullienne A, Chenais J, Lasmoles F, Guliana JM, Milhaud G, Moukhtar MS: The complete sequence of human preprocalcitonin. FEBS Lett. 1984 Feb 13;167(1):93-7. [PubMed:6546550 ]
  9. Riley JH, Edbrooke MR, Craig RK: Ectopic synthesis of high-Mr calcitonin by the BEN lung carcinoma cell line reflects aberrant proteolytic processing. FEBS Lett. 1986 Mar 17;198(1):71-9. [PubMed:3485540 ]
  10. Minvielle S, Giscard-Dartevelle S, Cohen R, Taboulet J, Labye F, Jullienne A, Rivaille P, Milhaud G, Moukhtar MS, Lasmoles F: A novel calcitonin carboxyl-terminal peptide produced in medullary thyroid carcinoma by alternative RNA processing of the calcitonin/calcitonin gene-related peptide gene. J Biol Chem. 1991 Dec 25;266(36):24627-31. [PubMed:1761559 ]
  11. Neher R, Riniker B, Rittel W, Zuber H: [Human calcitonin. Structure of calcitonin M and D]. Helv Chim Acta. 1968;51(8):1900-5. [PubMed:5760861 ]
  12. Motta A, Temussi PA, Wunsch E, Bovermann G: A 1H NMR study of human calcitonin in solution. Biochemistry. 1991 Mar 5;30(9):2364-71. [PubMed:2001366 ]
  13. Hillyard CJ, Myers C, Abeyasekera G, Stevvensvenson JC, Craig RK, MacIntyre I: Katacalcin: a new plasma calcium-lowering hormone. Lancet. 1983 Apr 16;1(8329):846-8. [PubMed:6132180 ]