You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07534
Secondary Accession Numbers
  • 13242
Name Calumenin
Synonyms
  1. Crocalbin
  2. IEF SSP 9302
Gene Name CALU
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Involved in regulation of vitamin K-dependent carboxylation of multiple amino-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Cellular Location
  1. Melanosome
  2. Secreted
  3. Endoplasmic reticulum lumen
  4. Sarcoplasmic reticulum lumen
Gene Properties
Chromosome Location Chromosome:7
Locus 7q32.1
SNPs CALU
Gene Sequence
>948 bp
ATGGACCTGCGACAGTTTCTTATGTGCCTGTCCCTGTGCACAGCCTTTGCCTTGAGCAAA
CCCACAGAAAAGAAGGACCGTGTACATCATGAGCCTCAGCTCAGTGACAAGGTTCACAAT
GATGCTCAGAGTTTTGATTATGACCATGATGCCTTCTTGGGTGCTGAAGAAGCAAAGACC
TTTGATCAGCTGACACCAGAAGAGAGCAAGGAAAGGCTTGGAAAGATTGTAAGTAAAATA
GATGGCGACAAGGACGGGTTTGTCACTGTGGATGAGCTCAAAGACTGGATTAAATTTGCA
CAAAAGCGCTGGATTTACGAGGATGTAGAGCGACAGTGGAAGGGGCATGACCTCAATGAG
GACGGCCTCGTTTCCTGGGAGGAGTATAAAAATGCCACCTACGGCTACGTTTTAGATGAT
CCAGATCCTGATGATGGATTTAACTATAAACAGATGATGGTTAGAGATGAGCGGAGGTTT
AAAATGGCAGACAAGGATGGAGACCTCATTGCCACCAAGGAGGAGTTCACAGCTTTCCTG
CACCCTGAGGAGTATGACTACATGAAAGATATAGTAGTACAGGAAACAATGGAAGATATA
GATAAGAATGCTGATGGTTTCATTGATCTAGAAGAGTATATTGGTGACATGTACAGCCAT
GATGGGAATACTGATGAGCCAGAATGGGTAAAGACAGAGCGAGAGCAGTTTGTTGAGTTT
CGGGATAAGAACCGTGATGGGAAGATGGACAAGGAAGAGACCAAAGACTGGATCCTTCCC
TCAGACTATGATCATGCAGAGGCAGAAGCCAGGCACCTGGTCTATGAATCAGACCAAAAC
AAGGATGGCAAGCTTACCAAGGAGGAGATCGTTGACAAGTATGACTTATTTGTTGGCAGC
CAGGCCACAGATTTTGGGGAGGCCTTAGTACGGCATGATGAGTTCTGA
Protein Properties
Number of Residues 315
Molecular Weight 37106.5
Theoretical pI 4.23
Pfam Domain Function Not Available
Signals
  • 1-19
Transmembrane Regions
  • None
Protein Sequence
>Calumenin
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNE
DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
GenBank ID Protein 3153209
UniProtKB/Swiss-Prot ID O43852
UniProtKB/Swiss-Prot Entry Name CALU_HUMAN
PDB IDs Not Available
GenBank Gene ID AF013759
GeneCard ID CALU
GenAtlas ID CALU
HGNC ID HGNC:1458
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Chi A, Valencia JC, Hu ZZ, Watabe H, Yamaguchi H, Mangini NJ, Huang H, Canfield VA, Cheng KC, Yang F, Abe R, Yamagishi S, Shabanowitz J, Hearing VJ, Wu C, Appella E, Hunt DF: Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes. J Proteome Res. 2006 Nov;5(11):3135-44. [PubMed:17081065 ]
  8. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  9. Basrur V, Yang F, Kushimoto T, Higashimoto Y, Yasumoto K, Valencia J, Muller J, Vieira WD, Watabe H, Shabanowitz J, Hearing VJ, Hunt DF, Appella E: Proteomic analysis of early melanosomes: identification of novel melanosomal proteins. J Proteome Res. 2003 Jan-Feb;2(1):69-79. [PubMed:12643545 ]
  10. Vorum H, Liu X, Madsen P, Rasmussen HH, Honore B: Molecular cloning of a cDNA encoding human calumenin, expression in Escherichia coli and analysis of its Ca2+-binding activity. Biochim Biophys Acta. 1998 Jul 28;1386(1):121-31. [PubMed:9675259 ]
  11. Yabe D, Taniwaki M, Nakamura T, Kanazawa N, Tashiro K, Honjo T: Human calumenin gene (CALU): cDNA isolation and chromosomal mapping to 7q32. Genomics. 1998 Apr 15;49(2):331-3. [PubMed:9598325 ]
  12. Vorum H, Hager H, Christensen BM, Nielsen S, Honore B: Human calumenin localizes to the secretory pathway and is secreted to the medium. Exp Cell Res. 1999 May 1;248(2):473-81. [PubMed:10222138 ]