Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07538
Secondary Accession Numbers
  • 13246
Name Calcium signal-modulating cyclophilin ligand
Synonyms
  1. CAML
Gene Name CAMLG
Protein Type Unknown
Biological Properties
General Function Involved in defense response
Specific Function Likely involved in the mobilization of calcium as a result of the TCR/CD3 complex interaction. Binds to cyclophilin B
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q23
SNPs CAMLG
Gene Sequence
>891 bp
ATGGAGTCGATGGCCGTCGCTACCGACGGCGGGGAGAGGCCGGGGGTCCCAGCGGGCTCA
GGTCTGTCGGCTTCCCAGCGTCGGGCGGAGCTGCGTCGGAGAAAGCTGCTCATGAACTCG
GAACAGCGCATCAACCGGATCATGGGCTTTCACAGGCCCGGGAGCGGCGCGGAAGAAGAA
AGTCAAACAAAATCAAAGCAGCAGGACAGTGATAAACTGAACTCCCTCAGCGTTCCTTCC
GTTTCAAAGCGAGTAGTGCTGGGTGATTCAGTCAGTACAGGAACAACTGACCAGCAGGGT
GGTGTGGCCGAGGTAAAGGGGACCCAACTGGGAGACAAATTGGACTCGTTCATTAAACCA
CCTGAGTGCAGTAGTGATGTCAACCTTGAGCTCCGGCAGCGGAACAGAGGGGACCTGACA
GCGGACTCGGTCCAGAGGGGTTCCCGCCATGGCCTAGAGCAGTACCTTTCCAGATTCGAA
GAAGCAATGAAGCTAAGGAAACAGCTGATTAGTGAAAAACCCAGTCAAGAGGATGGAAAT
ACAACAGAAGAATTTGACTCTTTTCGAATATTTAGATTGGTGGGATGTGCTCTTCTTGCT
CTTGGAGTCAGAGCTTTTGTTTGCAAATACTTGTCCATATTTGCTCCATTTCTTACTTTA
CAACTTGCGTACATGGGATTATACAAATATTTTCCCAAGAGTGAAAAGAAGATAAAGACA
ACAGTACTAACAGCTGCACTTCTATTGTCGGGAATTCCTGCCGAAGTGATAAATCGATCA
ATGGATACCTATAGCAAAATGGGCGAAGTCTTCACAGATCTCTGTGTCTACTTTTTCACT
TTTATCTTTTGTCATGAACTGCTTGATTATTGGGGCTCTGAAGTACCATGA
Protein Properties
Number of Residues 296
Molecular Weight 32952.3
Theoretical pI 8.19
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 190-210
  • 241-257
Protein Sequence
>Calcium signal-modulating cyclophilin ligand
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEE
SQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKP
PECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
TTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKT
TVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
GenBank ID Protein 619670
UniProtKB/Swiss-Prot ID P49069
UniProtKB/Swiss-Prot Entry Name CAMLG_HUMAN
PDB IDs Not Available
GenBank Gene ID U18242
GeneCard ID CAMLG
GenAtlas ID CAMLG
HGNC ID HGNC:1471
References
General References
  1. Bram RJ, Crabtree GR: Calcium signalling in T cells stimulated by a cyclophilin B-binding protein. Nature. 1994 Sep 22;371(6495):355-8. [PubMed:7522304 ]