Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07539
Secondary Accession Numbers
  • 13247
Name Calpain-10
Synonyms
  1. CANP 10
  2. Calcium-activated neutral proteinase 10
Gene Name CAPN10
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:2
Locus 2q37.3
SNPs CAPN10
Gene Sequence
>2019 bp
ATGCGGGCGGGCCGGGGCGCGACGCCGGCGAGGGAGCTGTTCCGGGACGCCGCCTTCCCC
GCCGCGGACTCCTCGCTCTTCTGCGACTTGTCTACGCCGCTGGCCCAGTTCCGCGAGGAC
ATCACGTGGAGGCGGCCCCAGGAGATTTGTGCCACACCCCGGCTGTTTCCAGATGACCCA
CGGGAAGGGCAGGTGAAGCAGGGGCTGCTGGGGGATTGCTGGTTCCTGTGTGCCTGCGCC
GCGCTGCAGAAGAGCAGGCACCTCCTGGACCAGGTCATTCCTCCGGGACAGCCGAGCTGG
GCCGACCAGGAGTACCGGGGCTCCTTCACCTGTCGCATTTGGCAGTTTGGACGCTGGGTG
GAGGTGACCACAGATGACCGCCTGCCGTGCCTTGCAGGGAGACTCTGTTTCTCCCGCTGC
CAGAGGGAGGATGTGTTCTGGCTCCCCTTACTGGAAAAGGTCTACGCCAAGGTCCATGGG
TCCTACGAGCACCTGTGGGCCGGGCAGGTGGCGGATGCCCTGGTGGACCTGACCGGCGGC
CTGGCAGAAAGATGGAACCTGAAGGGCGTAGCAGGAAGCGGAGGCCAGCAGGACAGGCCA
GGCCGCTGGGAGCACAGGACTTGTCGGCAGCTGCTCCACCTGAAGGACCAGTGTCTGATC
AGCTGCTGCGTGCTCAGCCCCAGAGCAGGTGCCCGGGAGCTGGGGGAGTTCCATGCCTTC
ATTGTCTCGGACCTGCGGGAGCTCCAGGGTCAGGCGGGCCAGTGCATCCTGCTGCTGCGG
ATCCAGAACCCCTGGGGCCGGCGGTGCTGGCAGGGGCTCTGGAGAGAGGGGGGTGAAGGG
TGGAGCCAGGTAGATGCAGCGGTAGCATCTGAGCTCCTGTCCCAGCTCCAGGAAGGGGAG
TTCTGGGTGGAGGAGGAGGAGTTCCTCAGGGAGTTTGACGAGCTCACCGTTGGCTACCCG
GTCACGGAGGCCGGCCACCTGCAGAGCCTCTACACAGAGAGGCTGCTCTGCCATACGCGG
GCGCTGCCTGGGGCCTGGGTCAAGGGCCAGTCAGCAGGAGGCTGCCGGAACAACAGCGGC
TTTCCCAGCAACCCCAAATTCTGGCTGCGGGTCTCAGAACCGAGTGAGGTGTACATTGCC
GTCCTGCAGAGATCCAGGCTGCACGCGGCGGACTGGGCAGGCCGGGCCCGGGCACTGGTG
GGTGACAGTCATACTTCGTGGAGCCCAGCGAGCATCCCGGGCAAGCACTACCAGGCTGTG
GGTCTGCACCTCTGGAAGGTAGAGAAGCGGCGGGTCAATCTGCCTAGGGTCCTGTCCATG
CCCCCCGTGGCTGGCACCGCGTGCCATGCATACGACCGGGAGGTCCACCTGCGTTGTGAG
CTCTCACCGGGCTACTACCTGGCTGTCCCCAGCACCTTCCTGAAGGACGCGCCAGGGGAG
TTCCTGCTCCGAGTCTTCTCTACCGGGCGAGTCTCCCTTAGCGCCATCAGGGCAGTGGCC
AAGAACACCACCCCCGGGGCAGCCCTGCCTGCGGGGGAGTGGGGGACCGTGCAGCTACGG
GGTTCTTGGAGAGTCGGCCAGACGGCGGGGGGCAGCAGGAACTTTGCCTCATACCCCACC
AACCCCTGCTTCCCCTTCTCGGTCCCCGAGGGCCCTGGCCCCCGCTGCGTCCGCATCACT
CTGCATCAGCACTGCCGGCCCAGTGACACCGAGTTCCACCCCATCGGCTTCCATATCTTC
CAGGTCCCAGAGGGTGGAAGGAGCCAGGACGCACCCCCACTGCTGCTGCAGGAGCCGCTG
CTGAGCTGCGTGCCACATCGCTACGCCCAGGAGGTGAGCCGGCTCTGCCTCCTGCCTGCG
GGCACCTACAAGGTTGTGCCCTCCACCTACCTGCCGGACACAGAGGGGGCCTTCACAGTG
ACCATCGCAACCAGGATTGACAGGCCATCCATTCACAGCCAGGAGATGCTGGGCCAGTTC
CTCCAAGAGGTCTCCGTCATGGCAGTGATGAAAACCTAA
Protein Properties
Number of Residues 672
Molecular Weight 74937.8
Theoretical pI 7.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-10
MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDP
REGQVKQGLLGDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWV
EVTTDDRLPCLAGRLCFSRCQREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGG
LAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAF
IVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEGWSQVDAAVASELLSQLQEGE
FWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQSAGGCRNNSG
FPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGE
FLLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPT
NPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPL
LSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQF
LQEVSVMAVMKT
GenBank ID Protein 13186302
UniProtKB/Swiss-Prot ID Q9HC96
UniProtKB/Swiss-Prot Entry Name CAN10_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_023083.3
GeneCard ID CAPN10
GenAtlas ID CAPN10
HGNC ID HGNC:1477
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. [PubMed:11347906 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  7. Horikawa Y, Oda N, Cox NJ, Li X, Orho-Melander M, Hara M, Hinokio Y, Lindner TH, Mashima H, Schwarz PE, del Bosque-Plata L, Horikawa Y, Oda Y, Yoshiuchi I, Colilla S, Polonsky KS, Wei S, Concannon P, Iwasaki N, Schulze J, Baier LJ, Bogardus C, Groop L, Boerwinkle E, Hanis CL, Bell GI: Genetic variation in the gene encoding calpain-10 is associated with type 2 diabetes mellitus. Nat Genet. 2000 Oct;26(2):163-75. [PubMed:11017071 ]
  8. Kang ES, Kim HJ, Nam M, Nam CM, Ahn CW, Cha BS, Lee HC: A novel 111/121 diplotype in the Calpain-10 gene is associated with type 2 diabetes. J Hum Genet. 2006;51(7):629-33. Epub 2006 May 24. [PubMed:16721485 ]