You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07542
Secondary Accession Numbers
  • 13250
Name Calpain-13
Synonyms
  1. CANP 13
  2. Calcium-activated neutral proteinase 13
Gene Name CAPN13
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Probable non-lysosomal thiol-protease
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:2
Locus 2p22-p21
SNPs CAPN13
Gene Sequence
>2010 bp
ATGGCGTATTACCAGGAGCCTTCAGTGGAGACCTCCATCATCAAGTTCAAAGACCAGGAC
TTTACCACCTTGCGGGATCACTGCCTGAGCATGGGCCGGACGTTTAAGGATGAGACATTC
CCTGCAGCAGATTCTTCCATAGGCCAGAAGCTGCTCCAGGAAAAACGCCTCTCCAATGTG
ATATGGAAGCGGCCACAGGATCTACCAGGGGGTCCTCCTCACTTCATCCTGGATGATATA
AGCAGATTTGACATCCAACAAGGAGGCGCAGCTGACTGCTGGTTCCTGGCAGCACTGGGA
TCCTTGACTCAGAACCCACAGTACAGGCAGAAGATCCTGATGGTCCAAAGCTTTTCACAC
CAGTATGCTGGCATTTTCCGTTTCCGGTTCTGGCAATGTGGCCAGTGGGTGGAAGTGGTG
ATTGATGACCGCCTACCTGTCCAGGGAGATAAATGCCTCTTTGTGCGTCCTCGCCACCAA
AACCAAGAGTTCTGGCCCTGCCTGCTGGAGAAGGCCTATGCCAAGCTGCTCGGATCCTAT
TCCGATCTGCACTATGGCTTCCTCGAGGATGCCCTGGTGGACCTCACAGGAGGCGTGATC
ACCAACATCCATCTGCACTCTTCCCCTGTGGACCTGGTGAAGGCAGTGAAGACAGCGACC
AAGGCAGGCTCCCTGATAACCTGTGCCACTCCAAGTGGGCCAACAGATACAGCACAGGCG
ATGGAGAATGGGCTGGTGAGTCTCCATGCCTACACTGTGACTGGGGCTGAGCAGATTCAA
TACCGAAGGGGCTGGGAAGAAATTATCTCCCTGTGGAACCCCTGGGGCTGGGGCGAGGCC
GAATGGAGAGGGCGCTGGAGTGATGGGTCTCAGGAGTGGGAGGAAACCTGTGATCCGCGG
AAAAGCCAGCTACATAAGAAACGGGAAGATGGCGAGTTTTGGATGTCGTGTCAAGATTTC
CAACAGAAATTCATCGCCATGTTTATATGTAGCGAAATTCCAATTACCCTGGACCATGGA
AACACACTCCACGAAGGATGGTCCCAAATAATGTTTAGGAAGCAAGTGATTCTAGGAAAC
ACTGCAGGAGGACCTCGGAATGATGCTCAATTCAACTTCTCTGTGCAAGAGCCAATGGAA
GGCACCAATGTTGTCGTGTGCGTCACAGTTGCTGTCACACCATCAAATTTGAAAGCAGAA
GATGCAAAATTTCCACTCGATTTCCAAGTGATTCTGGCTGGCTCACAGCGGTTCCGGGAG
AAATTTCCACCCGTGTTTTTTTCCTCGTTCAGAAACACTGTCCAAAGCTCAAATAATAAA
TTCCGCCGCAACTTCACCATGACTTACCATCTGAGCCCTGGGAACTATGTTGTGGTTGCA
CAGACACGGAGAAAATCAGCGGAGTTCTTGCTCCGAATCTTCCTGAAAATGCCAGACAGT
GACAGGCACCTGAGCAGCCATTTCAACCTCAGAATGAAGGGAAGCCCTTCAGAACATGGC
TCCCAACAAAGCATTTTCAACAGATATGCTCAGCAGAGGCTGGACATTGATGCCACCCAG
CTTCAGGGCCTTCTCAACCAGGAGCTTCTAACAGGACCTCCAGGGGACATGTTCTCCTTA
GATGAGTGCCGCAGCTTGGTGGCTCTGATGGAACTGAAAGTGAATGGGCGGCTAGACCAA
GAGGAGTTTGCGCGACTGTGGAAGCGCCTTGTTCACTACCAGCATGTTTTCCAGAAGGTT
CAGACAAGCCCTGGAGTCCTCCTGAGCTCGGACTTGTGGAAGGCCATAGAGAATACAGAC
TTCCTCAGAGGGATCTTCATCAGCCGTGAGCTGCTGCATCTGGTGACCCTCAGGTACAGC
GACAGCGTCGGCAGGGTCAGCTTCCCCAGCCTGGTCTGCTTCCTGATGCGGCTTGAAGCC
ATGGCAAAGACCTTCCGCAACCTCTCTAAGGATGGAAAAGGACTCTACCTGACAGAAATG
GAGTGGATGAGCCTGGTCATGTACAACTGA
Protein Properties
Number of Residues 669
Molecular Weight 76695.9
Theoretical pI 7.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-13
MAYYQEPSVETSIIKFKDQDFTTLRDHCLSMGRTFKDETFPAADSSIGQKLLQEKRLSNV
IWKRPQDLPGGPPHFILDDISRFDIQQGGAADCWFLAALGSLTQNPQYRQKILMVQSFSH
QYAGIFRFRFWQCGQWVEVVIDDRLPVQGDKCLFVRPRHQNQEFWPCLLEKAYAKLLGSY
SDLHYGFLEDALVDLTGGVITNIHLHSSPVDLVKAVKTATKAGSLITCATPSGPTDTAQA
MENGLVSLHAYTVTGAEQIQYRRGWEEIISLWNPWGWGEAEWRGRWSDGSQEWEETCDPR
KSQLHKKREDGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGN
TAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDAKFPLDFQVILAGSQRFRE
KFPPVFFSSFRNTVQSSNNKFRRNFTMTYHLSPGNYVVVAQTRRKSAEFLLRIFLKMPDS
DRHLSSHFNLRMKGSPSEHGSQQSIFNRYAQQRLDIDATQLQGLLNQELLTGPPGDMFSL
DECRSLVALMELKVNGRLDQEEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTD
FLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEM
EWMSLVMYN
GenBank ID Protein 41152101
UniProtKB/Swiss-Prot ID Q6MZZ7
UniProtKB/Swiss-Prot Entry Name CAN13_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_144575.2
GeneCard ID CAPN13
GenAtlas ID CAPN13
HGNC ID HGNC:16663
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Dear TN, Boehm T: Identification and characterization of two novel calpain large subunit genes. Gene. 2001 Aug 22;274(1-2):245-52. [PubMed:11675017 ]