Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07543
Secondary Accession Numbers
  • 13251
Name Calpain-14
Synonyms
  1. CANP 14
  2. Calcium-activated neutral proteinase 14
Gene Name CAPN14
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Calcium-regulated non-lysosomal thiol-protease
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:2
Locus 2p23.1-p21
SNPs CAPN14
Gene Sequence
>2055 bp
ATGTCTCTGTGGCCACCTTTCCGATGCAGATGGAAGCTGGCGCCAAGGTACTCTAGGAGG
GCGTCTCCACAGCAACCCCAACAGGACTTTGAGGCCCTGCTGGCAGAGTGCCTGAGGAAT
GGCTGCCTCTTTGAAGACACCAGCTTCCCGGCCACCCTGAGCTCCATCGGCAGTGGCTCC
CTGCTGCAGAAGCTGCCACCCCGCCTGCAGTGGAAGAGGCCCCCGGAGCTGCACAGCAAT
CCCCAGTTTTATTTTGCCAAGGCCAAAAGGCTGGATCTGTGCCAGGGGATAGTAGGAGAC
TGCTGGTTCTTGGCTGCTTTGCAAGCTCTGGCCTTGCACCAGGACATCCTGAGCCGGGTT
GTTCCCCTGAATCAGAGTTTCACTGAGAAGTATGCTGGCATCTTCCGGTTCTGGTTCTGG
CACTATGGGAACTGGGTTCCTGTGGTGATCGATGACCGTCTGCCTGTGAATGAGGCTGGC
CAGCTGGTCTTTGTCTCCTCCACCTATAAGAACTTGTTCTGGGGAGCACTTCTGGAAAAG
GCCTATGCCAAGCTCTCTGGTTCCTATGAAGACTTGCAGTCAGGACAGGTGTCTGAAGCC
CTTGTAGACTTCACTGGAGGGGTGACAATGACCATCAACCTGGCAGAAGCCCATGGCAAC
CTCTGGGACATCCTCATCGAAGCCACCTACAACAGAACCCTCATTGGCTGCCAGACCCAC
TCAGGGGAGAAGATTCTGGAGAATGGGCTGGTGGAAGGCCATGCCTATACTCTCACAGGA
ATCAGGAAGGTGACCTGCAAACATAGACCTGAATATCTCGTCAAGCTACGGAACCCCTGG
GGAAAGGTGGAATGGAAAGGAGACTGGAGTGACAGTTCAAGTAAATGGGAGCTGCTGAGC
CCCAAGGAGAAGATTCTGCTTCTGAGGAAAGACAATGACGGAGAATTCTGGATGACGCTG
CAGGACTTTAAAACACATTTCGTGCTCCTGGTTATCTGTAAACTGACCCCAGGCCTGTTG
AGCCAGGAGGCGGCCCAGAAGTGGACGTACACCATGCGGGAGGGGAGATGGGAGAAGCGG
AGCACAGCTGGTGGCCAGAGGCAGTTGCTGCAGGACACATTTTGGAAGAACCCGCAGTTC
CTGCTGTCTGTCTGGAGGCCCGAGGAGGGCAGGAGATCCCTGAGGCCCTGCAGCGTGCTG
GTGTCCCTGCTCCAGAAGCCCAGGCACAGGTGCCGCAAGCGGAAGCCTCTCCTCGCCATT
GGCTTCTACCTGTATAGGATGAACAAGTACCATGATGACCAGAGGAGACTGCCCCCTGAG
TTCTTCCAGAGAAACACTCCTCTGAGCCAGCCTGATAGGTTTCTCAAGGAGAAAGAAGTG
AGTCAGGAGCTGTGTCTGGAACCAGGGACGTACCTCATCGTGCCCTGCATATTGGAGGCC
CACCAGAAGTCAGAGTTCGTCCTCAGGGTCTTCTCCAGGAAGCACATCTTTTATGAAATT
GGCAGCAATTCTGGTGTCGTCTTCTCAAAGGAGATAGAAGACCAAAATGAAAGGCAGGAT
GAATTCTTCACCAAATTCTTTGAAAAGCATCCAGAGATTAATGCAGTTCAACTTCAGAAC
CTCCTGAACCAGATGACCTGGTCAAGTCTGGGGAGCAGACAGCCCTTCTTTAGCCTGGAA
GCCTGCCAGGGGATCCTGGCCTTACTGGACCTTAATGCATCAGGTACTATGAGCATCCAG
GAATTCAGGGACCTGTGGAAGCAGCTGAAGCTCTCTCAGAAGGTTTTCCACAAGCAAGAC
CGTGGGTCAGGATACCTGAACTGGGAGCAGCTGCACGCTGCCATGAGGGAGGCAGGAATC
ATGCTCAGTGATGACGTCTGTCAGCTGATGCTCATCCGCTACGGCGGCCCCCGCCTCCAG
ATGGACTTTGTCAGTTTCATCCACTTGATGCTGCGTGTAGAGAACATGGAGGATGTCTTC
CAAAACTTAACCCAAGATGGCAAAGGGATATACCTCCAGAAGCCAGAGTGGATGATGATG
GCACTGTACTCCTGA
Protein Properties
Number of Residues 684
Molecular Weight 79567.1
Theoretical pI 8.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-14
MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGS
LLQKLPPRLQWKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRV
VPLNQSFTEKYAGIFRFWFWHYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEAHGNLWDILIEATYNRTLIGCQTH
SGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPWGKVEWKGDWSDSSSKWELLS
PKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTYTMREGRWEKR
STAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEA
HQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQN
LLNQMTWSSLGSRQPFFSLEACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQD
RGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGGPRLQMDFVSFIHLMLRVENMEDVF
QNLTQDGKGIYLQKPEWMMMALYS
GenBank ID Protein 223468608
UniProtKB/Swiss-Prot ID A8MX76
UniProtKB/Swiss-Prot Entry Name CAN14_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001145122.1
GeneCard ID CAPN14
GenAtlas ID CAPN14
HGNC ID HGNC:16664
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Dear TN, Boehm T: Identification and characterization of two novel calpain large subunit genes. Gene. 2001 Aug 22;274(1-2):245-52. [PubMed:11675017 ]