You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07545
Secondary Accession Numbers
  • 13253
Name Calpain-2 catalytic subunit
Synonyms
  1. CANP 2
  2. Calcium-activated neutral proteinase 2
  3. Calpain M-type
  4. Calpain large polypeptide L2
  5. Calpain-2 large subunit
  6. M-calpain
  7. Millimolar-calpain
Gene Name CAPN2
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cell membrane
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q41-q42
SNPs CAPN2
Gene Sequence
>2103 bp
ATGGCGGGCATCGCGGCCAAGCTGGCGAAGGACCGGGAGGCGGCCGAGGGGCTGGGCTCC
CACGAGAGGGCCATCAAGTACCTCAACCAGGACTACGAGGCGCTGCGGAACGAGTGCCTG
GAGGCCGGGACGCTCTTCCAGGACCCGTCCTTCCCGGCCATCCCCTCGGCCCTGGGCTTC
AAGGAGTTGGGGCCCTACTCCAGCAAAACCCGGGGCATCGAGTGGAAGCGCCCCACGGAG
ATCTGCGCTGACCCCCAGTTTATCATTGGAGGAGCCACCCGCACAGACATCTGCCAAGGA
GCCCTGGGTGACTGCTGGCTGCTGGCAGCCATTGCCTCCCTCACCTTGAATGAAGAAATC
CTGGCTCGAGTCGTCCCCCTAAACCAGAGCTTCCAGGAAAACTATGCAGGGATCTTTCAC
TTCCAGTTCTGGCAATACGGCGAGTGGGTGGAGGTGGTGGTGGATGACAGGCTGCCCACC
AAGGACGGGGAGCTGCTCTTTGTGCATTCAGCCGAAGGGAGCGAGTTCTGGAGCGCCCTG
CTGGAGAAGGCATACGCCAAGATCAACGGATGCTATGAAGCGCTATCAGGGGGTGCCACC
ACTGAGGGCTTCGAAGACTTCACCGGAGGCATTGCTGAGTGGTATGAGTTGAAGAAGCCC
CCTCCCAACCTGTTCAAGATCATCCAGAAAGCTCTGCAAAAAGGCTCTCTCCTTGGCTGC
TCCATCGACATCACCAGCGCCGCGGACTCGGAGGCCATCACGTTTCAGAAGCTGGTGAAG
GGGCACGCGTACTCGGTCACCGGAGCCGAGGAGGTTGAAAGTAACGGAAGCCTACAGAAA
CTGATCCGCATCCGAAATCCCTGGGGAGAAGTGGAGTGGACAGGGCGGTGGAATGACAAC
TGCCCAAGCTGGAACACTATAGACCCAGAGGAGAGGGAAAGGCTGACCAGACGGCATGAA
GATGGAGAATTCTGGATGTCTTTCAGTGACTTCCTGAGGCACTATTCCCGCCTGGAGATC
TGTAACCTGACCCCAGACACTCTCACCAGCGATACCTACAAGAAGTGGAAACTCACCAAA
ATGGATGGGAACTGGAGGCGGGGCTCCACCGCGGGAGGTTGCAGGAACTACCCGAACACA
TTCTGGATGAACCCTCAGTACCTGATCAAGCTGGAGGAGGAGGATGAGGACGAGGAGGAT
GGGGAGAGCGGCTGCACCTTCCTGGTGGGGCTCATTCAGAAGCACCGACGGCGGCAGAGG
AAGATGGGCGAGGACATGCACACCATCGGCTTTGGCATCTATGAGGTTCCAGAGGAGTTA
AGTGGGCAGACCAACATCCACCTCAGCAAAAACTTCTTCCTGACGAATCGCGCCAGGGAG
CGCTCAGACACCTTCATCAACCTCCGGGAGGTGCTCAACCGCTTCAAGCTGCCGCCAGGA
GAGTACATTCTCGTGCCTTCCACCTTCGAACCCAACAAGGATGGGGATTTCTGCATCCGG
GTCTTTTCTGAAAAGAAAGCTGACTACCAAGCTGTCGATGATGAAATCGAGGCCAATCTT
GAAGAGTTCGACATCAGCGAGGATGACATTGATGATGGATTCAGGAGACTGTTTGCCCAG
TTGGCAGGAGAGGATGCGGAGATCTCTGCCTTTGAGCTGCAGACCATCCTGAGAAGGGTT
CTAGCAAAGCGCCAAGATATCAAGTCAGATGGCTTCAGCATCGAGACATGCAAAATTATG
GTTGACATGCTAGATTCGGACGGGAGTGGCAAGCTGGGGCTGAAGGAGTTCTACATTCTC
TGGACGAAGATTCAAAAATACCAAAAAATTTACCGAGAAATCGACGTTGACAGGTCTGGT
ACCATGAATTCCTATGAAATGCGGAAGGCATTAGAAGAAGCAGGTTTCAAGATGCCCTGT
CAACTCCACCAAGTCATCGTTGCTCGGTTTGCAGATGACCAGCTCATCATCGATTTTGAT
AATTTTGTTCGGTGTTTGGTTCGGCTGGAAACGCTATTCAAGATATTTAAGCAGCTGGAT
CCCGAGAATACTGGAACAATAGAGCTCGACCTTATCTCTTGGCTCTGTTTCTCAGTACTT
TGA
Protein Properties
Number of Residues 700
Molecular Weight 80008.6
Theoretical pI 4.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-2 catalytic subunit
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
GenBank ID Protein 157389005
UniProtKB/Swiss-Prot ID P17655
UniProtKB/Swiss-Prot Entry Name CAN2_HUMAN
PDB IDs
GenBank Gene ID NM_001748.4
GeneCard ID CAPN2
GenAtlas ID CAPN2
HGNC ID HGNC:1479
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  4. Ye Z, Connor JR: cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs. Biochem Biophys Res Commun. 2000 Aug 18;275(1):223-7. [PubMed:10944468 ]
  5. Imajoh S, Aoki K, Ohno S, Emori Y, Kawasaki H, Sugihara H, Suzuki K: Molecular cloning of the cDNA for the large subunit of the high-Ca2+-requiring form of human Ca2+-activated neutral protease. Biochemistry. 1988 Oct 18;27(21):8122-8. [PubMed:2852952 ]
  6. Hata A, Ohno S, Akita Y, Suzuki K: Tandemly reiterated negative enhancer-like elements regulate transcription of a human gene for the large subunit of calcium-dependent protease. J Biol Chem. 1989 Apr 15;264(11):6404-11. [PubMed:2539381 ]
  7. Strobl S, Fernandez-Catalan C, Braun M, Huber R, Masumoto H, Nakagawa K, Irie A, Sorimachi H, Bourenkow G, Bartunik H, Suzuki K, Bode W: The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium. Proc Natl Acad Sci U S A. 2000 Jan 18;97(2):588-92. [PubMed:10639123 ]