You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07549
Secondary Accession Numbers
  • 13257
Name Calpain-9
Synonyms
  1. Digestive tract-specific calpain
  2. New calpain 4
  3. Protein CG36
  4. nCL-4
Gene Name CAPN9
Protein Type Unknown
Biological Properties
General Function Involved in calcium-dependent cysteine-type endopeptidase activity
Specific Function Calcium-regulated non-lysosomal thiol-protease
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
endopeptidase activity
cysteine-type endopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
calcium-dependent cysteine-type endopeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
calcium ion binding
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 1q42.11-q42.3
SNPs CAPN9
Gene Sequence
>2073 bp
ATGCCTTACCTCTACCGGGCCCCAGGGCCTCAGGCACACCCGGTTCCCAAGGACGCCCGG
ATCACCCACTCCTCAGGCCAGAGCTTTGAGCAAATGAGGCAGGAGTGCCTGCAGAGAGGC
ACCCTGTTTGAGGATGCAGACTTCCCAGCCAGCAATTCCTCCCTGTTCTACAGTGAGAGG
CCGCAGATCCCCTTTGTGTGGAAACGACCAGGGGAAATCGTGAAAAACCCAGAATTCATT
CTTGGAGGGGCCACCAGGACTGATATCTGCCAGGGAGAGCTGGGAGACTGCTGGCTATTA
GCCGCCATCGCCTCCCTTACGCTTAATCAAAAAGCACTGGCCAGAGTCATCCCCCAGGAC
CAAAGCTTTGGCCCTGGTTATGCCGGGATATTCCATTTCCAGTTCTGGCAGCACAGTGAG
TGGCTGGACGTGGTGATCGATGACCGCCTGCCCACCTTCAGGGACCGCTTGGTTTTCCTC
CACTCTGCCGACCACAACGAGTTCTGGAGCGCCTTGCTGGAAAAAGCCTACGCCAAGCTA
AATGGGAGCTATGAAGCTCTGAAGGGAGGCAGCGCCATCGAGGCCATGGAAGACTTCACT
GGGGGTGTGGCAGAGACCTTCCAAACTAAAGAGGCCCCCGAGAACTTCTATGAGATTCTA
GAGAAGGCTTTGAAGAGAGGCTCCCTGCTGGGCTGCTTCATTGATACCAGAAGTGCTGCA
GAATCTGAGGCCCGGACGCCGTTTGGTCTTATTAAGGGTCATGCCTACAGTGTAACGGGA
ATTGACCAGGTAAGCTTCCGAGGCCAGAGAATCGAGCTCATCCGAATCCGGAACCCTTGG
GGCCAGGTTGAGTGGAACGGGTCGTGGAGCGACAGTTCTCCGGAGTGGCGTTCTGTTGGT
CCAGCTGAGCAGAAGCGTCTGTGTCACACTGCTCTGGATGATGGGGAATTCTGGATGGCA
TTTAAGGACTTCAAGGCCCACTTTGATAAAGTGGAGATCTGCAACCTCACTCCCGATGCC
CTGGAGGAAGACGCGATCCACAAATGGGAGGTGACGGTCCATCAGGGAAGCTGGGTTCGC
GGCTCCACGGCTGGGGGCTGCCGCAATTTCCTGGATACCTTTTGGACCAATCCACAAATA
AAATTGTCTCTGACTGAGAAAGATGAGGGGCAGGAGGAGTGTAGTTTCCTTGTAGCCCTG
ATGCAGAAAGATAGAAGGAAACTCAAGAGATTTGGTGCCAATGTGCTGACAATCGGCTAT
GCCATTTATGAGTGCCCTGACAAAGACGAACACCTGAACAAAGACTTCTTCAGATACCAC
GCTTCTCGGGCCAGAAGCAAGACGTTCATCAACCTGAGAGAAGTCTCCGACCGGTTCAAG
CTGCCCCCTGGGGAGTACATCCTGATTCCCAGCACTTTTGAGCCCCACCAGGAAGCTGAT
TTCTGTCTGAGAATCTTTTCAGAGAAAAAAGCCATTACCCGGGATATGGATGGAAATGTA
GACATTGACCTTCCTGAGCCTCCAAAGCCAACTCCACCTGACCAGGAGACAGAGGAGGAG
CAGCGGTTTCGGGCTCTGTTTGAACAAGTCGCTGGTGAGGACATGGAGGTGACAGCAGAG
GAACTTGAGTATGTTTTAAATGCTGTGCTGCAAAAGAAAAAGGACATCAAATTCAAGAAG
CTAAGCCTGATCTCCTGTAAAAACATCATTTCCCTGATGGACACCAGCGGCAATGGGAAG
CTGGAGTTTGATGAATTCAAAGTGTTCTGGGACAAGCTGAAGCAGTGGATTAACCTTTTC
CTTCGGTTTGATGCTGACAAGTCCGGCACCATGTCTACCTATGAACTACGGACTGCACTG
AAAGCTGCAGGCTTTCAGCTGAGCAGCCACCTCCTGCAGCTGATTGTGCTCAGGTATGCG
GATGAGGAGCTCCAGCTGGACTTCGATGACTTCCTCAACTGCCTGGTCCGGCTGGAGAAT
GCGAGCCGGGTGTTCCAGGCTCTCAGTACAAAGAACAAGGAGTTCATTCATCTCAATATA
AATGAGTTCATCCATTTGACAATGAACATCTGA
Protein Properties
Number of Residues 690
Molecular Weight 79095.8
Theoretical pI 5.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Calpain-9
MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSER
PQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQD
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAETFQTKEAPENFYEILEKALKRGSLLGCFIDTRSAA
ESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQVEWNGSWSDSSPEWRSVG
PAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGY
AIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEAD
FCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAE
ELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLF
LRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLEN
ASRVFQALSTKNKEFIHLNINEFIHLTMNI
GenBank ID Protein 5729758
UniProtKB/Swiss-Prot ID O14815
UniProtKB/Swiss-Prot Entry Name CAN9_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006615.2
GeneCard ID CAPN9
GenAtlas ID CAPN9
HGNC ID HGNC:1486
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Lee HJ, Sorimachi H, Jeong SY, Ishiura S, Suzuki K: Molecular cloning and characterization of a novel tissue-specific calpain predominantly expressed in the digestive tract. Biol Chem. 1998 Feb;379(2):175-83. [PubMed:9524069 ]
  3. Yoshikawa Y, Mukai H, Hino F, Asada K, Kato I: Isolation of two novel genes, down-regulated in gastric cancer. Jpn J Cancer Res. 2000 May;91(5):459-63. [PubMed:10835488 ]