Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07562
Secondary Accession Numbers
  • 13270
Name Voltage-dependent calcium channel gamma-2 subunit
Synonyms
  1. Neuronal voltage-gated calcium channel gamma-2 subunit
Gene Name CACNG2
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated calcium channel activity
Specific Function Thought to stabilize the calcium channel in an inactivated (closed) state
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
voltage-gated calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs CACNG2
Gene Sequence
>972 bp
ATGGGGCTGTTTGATCGAGGTGTTCAAATGCTTTTAACCACCGTTGGTGCTTTCGCTGCC
TTCAGCCTGATGACCATAGCTGTGGGAACCGACTATTGGCTCTACTCCAGAGGGGTTTGC
AAGACCAAAAGTGTCAGTGAGAATGAAACCAGCAAAAAGAACGAGGAAGTTATGACCCAT
TCCGGATTATGGAGAACCTGCTGCCTAGAAGGGAATTTCAAAGGTCTGTGCAAGCAAATT
GATCACTTCCCAGAGGATGCAGATTACGAAGCTGACACAGCAGAATATTTCCTCCGGGCC
GTGAGGGCCTCCAGCATTTTCCCAATCCTGAGTGTGATTCTGCTTTTCATGGGTGGCCTC
TGCATCGCAGCCAGCGAGTTCTACAAAACTCGACACAACATCATCCTGAGTGCCGGCATC
TTCTTCGTGTCTGCAGGTCTGAGTAACATCATTGGCATCATAGTGTACATATCTGCCAAT
GCCGGAGACCCCTCCAAGAGCGACTCCAAAAAGAATAGTTACTCATACGGCTGGTCCTTC
TACTTCGGGGCCCTGTCCTTCATCATCGCCGAGATGGTCGGGGTGCTGGCGGTGCACATG
TTTATCGACCGGCACAAACAGCTGCGGGCCACGGCCCGCGCCACGGACTACCTCCAGGCC
TCTGCCATCACCCGCATCCCCAGCTACCGCTACCGCTACCAGCGCCGCAGCCGCTCCAGC
TCGCGCTCCACGGAGCCCTCACACTCCAGGGACGCCTCCCCCGTGGGCATCAAGGGCTTC
AACACCCTGCCGTCCACGGAGATCTCCATGTACACGCTCAGCAGGGACCCCCTGAAGGCC
GCCACCACGCCCACCGCCACCTACAACTCCGACAGGGATAACAGCTTCCTCCAGGTTCAC
AACTGTATCCAGAAGGAGAACAAGGACTCTCTCCACTCCAACACAGCCAACCGCCGGACC
ACCCCCGTATAA
Protein Properties
Number of Residues 323
Molecular Weight 35965.4
Theoretical pI 9.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 10-30
  • 104-124
  • 134-154
  • 182-202
Protein Sequence
>Voltage-dependent calcium channel gamma-2 subunit
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH
NCIQKENKDSLHSNTANRRTTPV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y698
UniProtKB/Swiss-Prot Entry Name CCG2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF096322
GeneCard ID CACNG2
GenAtlas ID CACNG2
HGNC ID HGNC:1406
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Black JL 3rd, Lennon VA: Identification and cloning of putative human neuronal voltage-gated calcium channel gamma-2 and gamma-3 subunits: neurologic implications. Mayo Clin Proc. 1999 Apr;74(4):357-61. [PubMed:10221464 ]