You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07565
Secondary Accession Numbers
  • 13273
Name Voltage-dependent calcium channel gamma-5 subunit
Synonyms
  1. Neuronal voltage-gated calcium channel gamma-5 subunit
Gene Name CACNG5
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion transport
Specific Function Thought to stabilize the calcium channel in an inactivated (closed) state
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24
SNPs CACNG5
Gene Sequence
>828 bp
ATGAGTGCCTGCGGGAGGAAGGCCCTGACCCTGCTGAGCAGTGTCTTTGCTGTCTGTGGC
TTGGGCCTCCTGGGTATCGCGGTCAGCACCGACTACTGGCTGTACCTGGAGGAGGGTGTG
ATTGTGCCCCAGAACCAGAGCACCGAGATCAAGATGTCCCTGCACTCAGGCCTCTGGCGG
GTCTGCTTCCTTGCAGGTGAGGAGCGGGGGCGTTGCTTCACCATAGAATATGTGATGCCC
ATGAACACCCAGCTGACATCCGAGTCCACGGTCAATGTTCTAAAGATGATCCGCTCAGCC
ACACCATTCCCTCTGGTCAGCCTCTTCTTCATGTTCATTGGGTTTATCCTGAACAACATC
GGACACATCCGTCCCCACCGGACGATACTGGCCTTTGTCTCTGGCATCTTCTTTATCCTC
TCAGGCCTCTCTCTCGTGGTGGGCCTGGTGCTCTACATCTCCAGCATCAACGATGAGATG
CTCAACAGGACCAAGGATGCAGAGACCTACTTCAACTACAAGTATGGGTGGTCGTTTGCC
TTCGCCGCCATCTCCTTCCTTTTAACGGAGAGTGCCGGGGTGATGTCTGTGTACCTGTTT
ATGAAGCGGTACACCGCGGAGGACATGTACAGGCCCCACCCTGGCTTCTACCGCCCTCGG
CTGAGCAACTGCTCCGATTACTCAGGCCAGTTCCTACACCCAGACGCCTGGGTCAGGGGC
CGCAGCCCCTCCGACATCTCCAGCGAGGCCTCCCTGCAGATGAACAGCAACTACCCCGCC
TTGCTCAAGTGCCCCGACTATGATCAGATGTCCTCTTCACCCTGCTGA
Protein Properties
Number of Residues 275
Molecular Weight 30902.4
Theoretical pI 7.38
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-28
  • 103-123
  • 129-149
  • 176-196
Protein Sequence
>Voltage-dependent calcium channel gamma-5 subunit
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
GenBank ID Protein 22027551
UniProtKB/Swiss-Prot ID Q9UF02
UniProtKB/Swiss-Prot Entry Name CCG5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_145811.1
GeneCard ID CACNG5
GenAtlas ID CACNG5
HGNC ID HGNC:1409
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Burgess DL, Davis CF, Gefrides LA, Noebels JL: Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication. Genome Res. 1999 Dec;9(12):1204-13. [PubMed:10613843 ]
  4. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [PubMed:11738816 ]
  5. Moss FJ, Viard P, Davies A, Bertaso F, Page KM, Graham A, Canti C, Plumpton M, Plumpton C, Clare JJ, Dolphin AC: The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression. EMBO J. 2002 Apr 2;21(7):1514-23. [PubMed:11927536 ]