You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07566
Secondary Accession Numbers
  • 13274
Name Voltage-dependent calcium channel gamma-6 subunit
Synonyms
  1. Neuronal voltage-gated calcium channel gamma-6 subunit
Gene Name CACNG6
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion transport
Specific Function Thought to stabilize the calcium channel in an inactivated (closed) state
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs CACNG6
Gene Sequence
>783 bp
ATGATGTGGTCCAACTTCTTCCTGCAAGAGGAGAACCGGCGGCGGGGGGCCGCGGGCCGG
CGGCGGGCGCACGGGCAGGGCAGGTCGGGGCTGACGCCCGAGCGCGAGGGGAAGGTGAAG
CTGGCGCTGCTGCTGGCCGCCGTGGGCGCCACGCTGGCGGTGCTGTCCGTGGGCACCGAG
TTCTGGGTGGAGCTCAACACCTACAAGGCCAACGGCAGCGCCGTGTGCGAAGCGGCCCAC
CTGGGGCTGTGGAAGGCGTGCACCAAGCGGCTGTGGCAGGCGGACGTGCCCGTGGACAGG
GACACCTGCGGCCCCGCGGAGCTGCCCGGAGAAGCAAACTGCACCTATTTTAAATTCTTC
ACCACGGGGGAGAATGCACGCATCTTTCAGAGAACCACAAAGAAAGAGGTGAATCTGGCA
GCTGCGGTGATAGCAGTGCTGGGCCTGGCAGTCATGGCCTTGGGGTGCCTCTGTATCATC
ATGGTGCTCAGTAAAGGTGCAGAGTTCCTGCTCCGAGTTGGAGCCGTCTGCTTTGGCCTC
TCAGGCCTGCTGCTCTTGGTGAGCCTGGAGGTGTTCCGGCATTCCGTGAGGGCCCTGCTG
CAGAGAGTCAGCCCGGAGCCTCCCCCGGCCCCACGCCTCACCTACGAGTACTCCTGGTCC
CTGGGCTGCGGCGTGGGGGCCGGCCTGATCCTGCTGTTGGGGGCCGGCTGCTTTCTGCTG
CTCACACTGCCTTCCTGGCCCTGGGGGTCCCTCTGTCCCAAGCGGGGGCACCGGGCCACC
TAG
Protein Properties
Number of Residues 260
Molecular Weight 28128.7
Theoretical pI 9.44
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 43-63
  • 143-163
  • 169-189
  • 221-241
Protein Sequence
>Voltage-dependent calcium channel gamma-6 subunit
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE
FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF
TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL
LTLPSWPWGSLCPKRGHRAT
GenBank ID Protein 13357176
UniProtKB/Swiss-Prot ID Q9BXT2
UniProtKB/Swiss-Prot Entry Name CCG6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF288386
GeneCard ID CACNG6
GenAtlas ID CACNG6
HGNC ID HGNC:13625
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [PubMed:11738816 ]
  3. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. [PubMed:11170751 ]