You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07567
Secondary Accession Numbers
  • 13275
Name Voltage-dependent calcium channel gamma-7 subunit
Synonyms
  1. Neuronal voltage-gated calcium channel gamma-7 subunit
Gene Name CACNG7
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion transport
Specific Function Thought to stabilize the calcium channel in an inactivated (closed) state
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs CACNG7
Gene Sequence
>828 bp
ATGAGTCACTGCAGCAGCCGCGCCCTGACCCTGCTGAGCAGCGTGTTTGGTGCGTGTGGC
CTGCTCCTGGTAGGCATCGCGGTCAGCACTGACTACTGGCTGTACATGGAAGAAGGCACA
GTGCTACCGCAGAACCAGACCACCGAGGTCAAGATGGCCCTGCACGCCGGCCTCTGGCGA
GTCTGCTTCTTTGCAGGTCGGGAGAAAGGTCGCTGTGTGGCCTCAGAATATTTTCTTGAA
CCGGAGATCAATTTGGTGACGGAAAACACGGAGAATATTCTGAAGACAGTGCGCACGGCC
ACCCCCTTCCCCATGGTCAGCCTCTTCCTCGTGTTCACGGCCTTCGTCATCAGCAACATC
GGCCACATCCGCCCGCAGAGGACCATTCTGGCTTTTGTCTCTGGCATCTTCTTCATACTA
TCGGGCCTCTCCTTGGTGGTGGGCTTGGTTCTTTACATCTCCAGCATCAACGACGAGGTC
ATGAACAGGCCCAGCAGCTCTGAGCAGTATTTTCATTATCGCTACGGGTGGTCTTTTGCC
TTCGCCGCTTCCTCCTTCCTACTCAAAGAGGGGGCCGGCGTGATGTCCGTGTACCTGTTC
ACCAAGCGCTACGCGGAGGAGGAGATGTACCGTCCACACCCGGCCTTCTACCGCCCGCGT
CTCAGCGACTGCTCCGACTACTCGGGCCAGTTCCTGCAGCCCGAGGCGTGGCGCCGCGGC
CGGAGCCCCTCCGACATCTCCAGCGACGTGTCCATCCAAATGACGCAGAACTACCCTCCC
GCCATCAAGTACCCGGACCACCTGCACATCTCCACCTCGCCCTGCTGA
Protein Properties
Number of Residues 275
Molecular Weight 31002.3
Theoretical pI 7.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-28
  • 103-123
  • 129-149
  • 179-199
Protein Sequence
>Voltage-dependent calcium channel gamma-7 subunit
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
GenBank ID Protein 21361975
UniProtKB/Swiss-Prot ID P62955
UniProtKB/Swiss-Prot Entry Name CCG7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031896.3
GeneCard ID CACNG7
GenAtlas ID CACNG7
HGNC ID HGNC:13626
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  3. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [PubMed:11738816 ]
  4. Moss FJ, Viard P, Davies A, Bertaso F, Page KM, Graham A, Canti C, Plumpton M, Plumpton C, Clare JJ, Dolphin AC: The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression. EMBO J. 2002 Apr 2;21(7):1514-23. [PubMed:11927536 ]
  5. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. [PubMed:11170751 ]