You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07568
Secondary Accession Numbers
  • 13276
Name Voltage-dependent calcium channel gamma-8 subunit
Synonyms
  1. Neuronal voltage-gated calcium channel gamma-8 subunit
Gene Name CACNG8
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion transport
Specific Function Thought to stabilize the calcium channel in an inactivated (closed) state
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.4
SNPs CACNG8
Gene Sequence
>1278 bp
CTGGAGTCGCTGAAGCGCTGGAACGAAGAGCGGGGCCTCTGGTGCGAGAAGGGGGTGCAG
GTGCTGCTGACGACGGTGGGCGCCTTCGCCGCCTTCGGCCTCATGACCATCGCCATCAGC
ACTGACTACTGGCTCTACACGCGCGCCCTCATCTGCAACACCACCAACCTCACGGCCGGC
GGCGACGACGGGACCCCCCACCGCGGGGGCGGCGGCGCCTCGGAGAAGAAGGACCCCGGC
GGCCTCACGCACTCGGGCCTCTGGAGGATCTGCTGCCTGGAAGGGTTGAAAAGAGGCGTC
TGCGTGAAGATCAATCATTTCCCGGAGGACACGGACTACGACCACGACAGCGCGGAGTAT
CTACTCCGAGTTGTCCGGGCCTCCAGCATCTTCCCCATCCTTAGCGCCATCCTGCTGCTG
CTCGGGGGTGTGTGCGTGGCGGCCTCCCGCGTCTACAAGTCCAAGAGGAACATCATTCTG
GGCGCAGGGATCCTGTTCGTGGCAGCAGGCCTGAGCAACATCATCGGCGTGATCGTGTAC
ATCTCCGCCAACGCGGGCGAGCCGGGCCCGAAGCGGGACGAGGAGAAGAAAAACCACTAC
TCGTACGGCTGGTCCTTCTACTTCGGCGGGCTGTCGTTCATCCTGGCCGAGGTGATAGGC
GTGCTGGCCGTCAACATCTACATCGAGCGCAGCCGCGAGGCGCACTGCCAGTCTCGCTCG
GACCTGCTCAAGGCCGGCGGGGGCGCGGGCGGCAGTGGCGGGAGCGGCCCCTCGGCCATC
CTCCGTCTGCCCAGTTACCGCTTCCGCTACCGCCGCCGCTCCCGCTCTAGCTCCCGCTCC
AGCGAGCCGTCGCCGTCGCGGGACGCGTCTCCCGGCGGCCCCGGGGGCCCGGGCTTTGCC
TCCACGGACATCTCCATGTACACGCTCAGCCGCGACCCCTCCAAGGGCAGCGTGGCCGCG
GGGCTGGCGGGGGCCGGCGGCGGCGGCGGCGGCGCCGTGGGGGCGTTCGGCGGCGCGGCC
GGGGGCGCCGGGGGCGGCGGCGGAGGCGGCGGCGGGGCGGGTGCCGAGCGGGACCGCGGG
GGGGCGTCCGGCTTCCTCACGCTGCACAACGCCTTCCCCAAGGAGGCGGGCGGCGGCGTC
ACGGTCACGGTCACCGGGCCGCCCGCCCCGCCCGCGCCCGCGCCACCCGCGCCCTCTGCG
CCCGCCCCCGGGACCCTGGCCAAGGAGGCCGCCGCCTCCAACACCAACACGCTCAACAGG
AAAACCACGCCTGTGTAG
Protein Properties
Number of Residues 425
Molecular Weight 43480.7
Theoretical pI 9.85
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 19-39
  • 129-149
  • 158-178
  • 208-228
  • 318-338
Protein Sequence
>Voltage-dependent calcium channel gamma-8 subunit
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GSSGFLTLHNAFPKEAGGGVTVTVTRPPAPPAPRHPAPSAPAPGTLAKGAAASNTNTLNR
KTTPV
GenBank ID Protein 24586686
UniProtKB/Swiss-Prot ID Q8WXS5
UniProtKB/Swiss-Prot Entry Name CCG8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031895.4
GeneCard ID CACNG8
GenAtlas ID CACNG8
HGNC ID HGNC:13628
References
General References
  1. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [PubMed:11738816 ]
  2. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. [PubMed:11170751 ]