You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07580
Secondary Accession Numbers
  • 13288
Name C-C chemokine receptor type 9
Synonyms
  1. C-C CKR-9
  2. CC-CKR-9
  3. CCR-9
  4. CDw199 antigen
  5. G-protein coupled receptor 28
  6. GPR-9-6
Gene Name CCR9
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
g-protein chemoattractant receptor activity
chemokine receptor activity
c-c chemokine receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.3
SNPs CCR9
Gene Sequence
>1110 bp
ATGACACCCACAGACTTCACAAGCCCTATTCCTAACATGGCTGATGACTATGGCTCTGAA
TCCACATCTTCCATGGAAGACTACGTTAACTTCAACTTCACTGACTTCTACTGTGAGAAA
AACAATGTCAGGCAGTTTGCGAGCCATTTCCTCCCACCCTTGTACTGGCTCGTGTTCATC
GTGGGTGCCTTGGGCAACAGTCTTGTTATCCTTGTCTACTGGTACTGCACAAGAGTGAAG
ACCATGACCGACATGTTCCTTTTGAATTTGGCAATTGCTGACCTCCTCTTTCTTGTCACT
CTTCCCTTCTGGGCCATTGCTGCTGCTGACCAGTGGAAGTTCCAGACCTTCATGTGCAAG
GTGGTCAACAGCATGTACAAGATGAACTTCTACAGCTGTGTGTTGCTGATCATGTGCATC
AGCGTGGACAGGTACATTGCCATTGCCCAGGCCATGAGAGCACATACTTGGAGGGAGAAA
AGGCTTTTGTACAGCAAAATGGTTTGCTTTACCATCTGGGTATTGGCAGCTGCTCTCTGC
ATCCCAGAAATCTTATACAGCCAAATCAAGGAGGAATCCGGCATTGCTATCTGCACCATG
GTTTACCCTAGCGATGAGAGCACCAAACTGAAGTCAGCTGTCTTGACCCTGAAGGTCATT
CTGGGGTTCTTCCTTCCCTTCGTGGTCATGGCTTGCTGCTATACCATCATCATTCACACC
CTGATACAAGCCAAGAAGTCTTCCAAGCACAAAGCCCTAAAAGTGACCATCACTGTCCTG
ACCGTCTTTGTCTTGTCTCAGTTTCCCTACAACTGCATTTTGTTGGTGCAGACCATTGAC
GCCTATGCCATGTTCATCTCCAACTGTGCCGTTTCCACCAACATTGACATCTGCTTCCAG
GTCACCCAGACCATCGCCTTCTTCCACAGTTGCCTGAACCCTGTTCTCTATGTTTTTGTG
GGTGAGAGATTCCGCCGGGATCTCGTGAAAACCCTGAAGAACTTGGGTTGCATCAGCCAG
GCCCAGTGGGTTTCATTTACAAGGAGAGAGGGAAGCTTGAAGCTGTCGTCTATGTTGCTG
GAGACAACCTCAGGAGCACTCTCCCTCTGA
Protein Properties
Number of Residues 369
Molecular Weight 42015.3
Theoretical pI 8.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 54-74
  • 86-106
  • 128-148
  • 167-187
  • 219-239
  • 255-275
  • 301-321
Protein Sequence
>C-C chemokine receptor type 9
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
GenBank ID Protein 4886432
UniProtKB/Swiss-Prot ID P51686
UniProtKB/Swiss-Prot Entry Name CCR9_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ132337
GeneCard ID CCR9
GenAtlas ID CCR9
HGNC ID HGNC:1610
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zaballos A, Gutierrez J, Varona R, Ardavin C, Marquez G: Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK. J Immunol. 1999 May 15;162(10):5671-5. [PubMed:10229797 ]
  3. Yu CR, Peden KW, Zaitseva MB, Golding H, Farber JM: CCR9A and CCR9B: two receptors for the chemokine CCL25/TECK/Ck beta-15 that differ in their sensitivities to ligand. J Immunol. 2000 Feb 1;164(3):1293-305. [PubMed:10640743 ]