Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07583
Secondary Accession Numbers
  • 13291
Name Centrin-2
Synonyms
  1. Caltractin isoform 1
Gene Name CETN2
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Plays a fundamental role in microtubule-organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CEP110
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
atp-dependent helicase activity
atpase activity
atpase activity, coupled
nucleic acid binding
nucleoside-triphosphatase activity
calcium ion binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasm
  2. cytoskeleton
  3. centrosome
  4. centriole
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs CETN2
Gene Sequence
>519 bp
ATGGCCTCCAACTTTAAGAAGGCAAACATGGCATCAAGTTCTCAGCGAAAAAGAATGAGC
CCTAAGCCTGAGCTTACTGAAGAGCAAAAGCAGGAGATCCGGGAAGCTTTTGATCTTTTC
GATGCGGATGGAACTGGCACCATAGATGTTAAAGAACTGAAGGTGGCAATGAGGGCCCTG
GGCTTTGAACCCAAGAAAGAAGAAATTAAGAAAATGATAAGTGAAATTGATAAGGAAGGG
ACAGGAAAAATGAACTTTGGTGACTTTTTAACTGTGATGACCCAGAAAATGTCTGAGAAA
GATACTAAAGAAGAAATCCTGAAAGCTTTCAAGCTCTTTGATGATGATGAAACTGGGAAG
ATTTCGTTCAAAAATCTGAAACGCGTGGCCAAGGAGTTGGGTGAGAACCTGACTGATGAG
GAGCTGCAGGAAATGATTGATGAAGCTGATCGAGATGGAGATGGAGAGGTCAGTGAGCAA
GAGTTCCTGCGCATCATGAAAAAGACCAGCCTCTATTAA
Protein Properties
Number of Residues 172
Molecular Weight 19738.3
Theoretical pI 4.62
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Centrin-2
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
GenBank ID Protein 189065158
UniProtKB/Swiss-Prot ID P41208
UniProtKB/Swiss-Prot Entry Name CETN2_HUMAN
PDB IDs
GenBank Gene ID AK311940
GeneCard ID CETN2
GenAtlas ID CETN2
HGNC ID HGNC:1867
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  6. Mallon AM, Platzer M, Bate R, Gloeckner G, Botcherby MR, Nordsiek G, Strivens MA, Kioschis P, Dangel A, Cunningham D, Straw RN, Weston P, Gilbert M, Fernando S, Goodall K, Hunter G, Greystrong JS, Clarke D, Kimberley C, Goerdes M, Blechschmidt K, Rump A, Hinzmann B, Mundy CR, Miller W, Poustka A, Herman GE, Rhodes M, Denny P, Rosenthal A, Brown SD: Comparative genome sequence analysis of the Bpa/Str region in mouse and Man. Genome Res. 2000 Jun;10(6):758-75. [PubMed:10854409 ]
  7. Tsang WY, Spektor A, Luciano DJ, Indjeian VB, Chen Z, Salisbury JL, Sanchez I, Dynlacht BD: CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability. Mol Biol Cell. 2006 Aug;17(8):3423-34. Epub 2006 Jun 7. [PubMed:16760425 ]
  8. Lee VD, Huang B: Molecular cloning and centrosomal localization of human caltractin. Proc Natl Acad Sci U S A. 1993 Dec 1;90(23):11039-43. [PubMed:8248209 ]
  9. Salisbury JL, Suino KM, Busby R, Springett M: Centrin-2 is required for centriole duplication in mammalian cells. Curr Biol. 2002 Aug 6;12(15):1287-92. [PubMed:12176356 ]
  10. Martinez-Sanz J, Yang A, Blouquit Y, Duchambon P, Assairi L, Craescu CT: Binding of human centrin 2 to the centrosomal protein hSfi1. FEBS J. 2006 Oct;273(19):4504-15. Epub 2006 Sep 5. [PubMed:16956364 ]
  11. Matei E, Miron S, Blouquit Y, Duchambon P, Durussel I, Cox JA, Craescu CT: C-terminal half of human centrin 2 behaves like a regulatory EF-hand domain. Biochemistry. 2003 Feb 18;42(6):1439-50. [PubMed:12578356 ]
  12. Yang A, Miron S, Duchambon P, Assairi L, Blouquit Y, Craescu CT: The N-terminal domain of human centrin 2 has a closed structure, binds calcium with a very low affinity, and plays a role in the protein self-assembly. Biochemistry. 2006 Jan 24;45(3):880-9. [PubMed:16411764 ]
  13. Yang A, Miron S, Mouawad L, Duchambon P, Blouquit Y, Craescu CT: Flexibility and plasticity of human centrin 2 binding to the xeroderma pigmentosum group C protein (XPC) from nuclear excision repair. Biochemistry. 2006 Mar 21;45(11):3653-63. [PubMed:16533048 ]
  14. Thompson JR, Ryan ZC, Salisbury JL, Kumar R: The structure of the human centrin 2-xeroderma pigmentosum group C protein complex. J Biol Chem. 2006 Jul 7;281(27):18746-52. Epub 2006 Apr 20. [PubMed:16627479 ]