You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07587
Secondary Accession Numbers
  • 13295
Name C-type lectin domain family 10 member A
Synonyms
  1. C-type lectin superfamily member 14
  2. CD301 antigen
  3. Macrophage lectin 2
Gene Name CLEC10A
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs CLEC10A
Gene Sequence
>951 bp
ATGACAAGGACGTATGAAAACTTCCAGTACTTGGAGAATAAGGTGAAAGTCCAGGGGTTT
AAAAATGGGCCACTTCCTCTCCAGTCCCTCCTGCAGCGTCTCTGCTCTGGGCCCTGCCAT
CTCCTGCTGTCCCTGGGCCTCGGCCTCCTGCTGCTGGTCATCATCTGTGTGGTTGGATTC
CAAAATTCCAAATTTCAGAGGGACCTGGTGACCCTGAGAACAGATTTTAGCAACTTCACC
TCAAACACTGTGGCGGAGATCCAGGCACTGACTTCCCAGGGCAGCAGCTTGGAAGAAACG
ATAGCATCTCTGAAAGCTGAGGTGGAGGGTTTCAAGCAGGAACGGCAGGCAGGGGTATCT
GAGCTCCAGGAACACACTACGCAGAAGGCACACCTAGGCCACTGTCCCCACTGCCCATCT
GTGTGTGTCCCAGTTCATTCTGAAATGCTCCTGCGAGTCCAGCAGCTGGTGCAAGACCTG
AAGAAACTGACCTGCCAGGTGGCTACTCTCAACAACAATGCCTCCACTGAAGGGACCTGC
TGCCCTGTCAACTGGGTGGAGCACCAAGACAGCTGCTACTGGTTCTCTCACTCTGGGATG
TCCTGGGCCGAGGCTGAGAAGTACTGCCAGCTGAAGAACGCCCACCTGGTGGTCATCAAC
TCCAGGGAGGAGCAGAATTTTGTCCAGAAATATCTAGGCTCCGCATACACCTGGATGGGC
CTCAGTGACCCTGAAGGAGCCTGGAAGTGGGTGGATGGAACAGACTATGCGACCGGCTTC
CAGAACTGGAAGCCAGGCCAGCCAGACGACTGGCAGGGGCACGGGCTGGGTGGAGGCGAG
GACTGTGCTCACTTCCATCCAGACGGCAGGTGGAATGACGACGTCTGCCAGAGGCCCTAC
CACTGGGTCTGCGAGGCTGGCCTGGGTCAGACCAGCCAGGAGAGTCACTGA
Protein Properties
Number of Residues 316
Molecular Weight 35445.7
Theoretical pI 5.99
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 40-60
Protein Sequence
>C-type lectin domain family 10 member A
MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGF
QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVS
ELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTC
CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMG
LSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPY
HWVCEAGLGQTSQESH
GenBank ID Protein 33667103
UniProtKB/Swiss-Prot ID Q8IUN9
UniProtKB/Swiss-Prot Entry Name CLC10_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_182906.2
GeneCard ID CLEC10A
GenAtlas ID CLEC10A
HGNC ID HGNC:16916
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Suzuki N, Yamamoto K, Toyoshima S, Osawa T, Irimura T: Molecular cloning and expression of cDNA encoding human macrophage C-type lectin. Its unique carbohydrate binding specificity for Tn antigen. J Immunol. 1996 Jan 1;156(1):128-35. [PubMed:8598452 ]