Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07589
Secondary Accession Numbers
  • 13297
Name C-type lectin domain family 4 member C
Synonyms
  1. BDCA-2
  2. Blood dendritic cell antigen 2
  3. C-type lectin superfamily member 7
  4. CD303 antigen
  5. Dendritic lectin
Gene Name CLEC4C
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein- tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.2-p12.3
SNPs CLEC4C
Gene Sequence
>642 bp
ATGGTGCCTGAAGAAGAGCCTCAAGACCGAGAGAAAGGACTCTGGTGGTTCCAGTTGAAG
GTCTGGTCCATGGCAGTCGTATCCATCTTGCTCCTCAGTGTCTGTTTCACTGTGAGTTCT
GTGGTGCCTCACAATTTTATGTATAGCAAAACTGTCAAGAGGCTGTCCAAGTTACGAGAG
TATCAACAGTATCATCCAAGCCTGACCTGCGTCATGGAAGGAAAGGACATAGAAGATTGG
AGCTGCTGCCCAACCCCTTGGACTTCATTTCAGTCTAGTTGCTACTTTATTTCTACTGGG
ATGCAATCTTGGACTAAGAGTCAAAAGAACTGTTCTGTGATGGGGGCTGATCTGGTGGTG
ATCAACACCAGGGAAGAACAGGATTTCATCATTCAGAATCTGAAAAGAAATTCTTCTTAT
TTTCTGGGGCTGTCAGATCCAGGGGGTCGGCGACATTGGCAATGGGTTGACCAGACACCA
TACAATGAAAATGTCACATTCTGGCACTCAGGTGAACCCAATAACCTTGATGAGCGTTGT
GCGATAATAAATTTCCGTTCTTCAGAAGAATGGGGCTGGAATGACATTCACTGTCATGTA
CCTCAGAAGTCAATTTGCAAGATGAAGAAGATCTACATATAA
Protein Properties
Number of Residues 213
Molecular Weight 25037.4
Theoretical pI 7.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 22-44
Protein Sequence
>C-type lectin domain family 4 member C
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLRE
YQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVV
INTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERC
AIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
GenBank ID Protein 17224598
UniProtKB/Swiss-Prot ID Q8WTT0
UniProtKB/Swiss-Prot Entry Name CLC4C_HUMAN
PDB IDs Not Available
GenBank Gene ID AF293615
GeneCard ID CLEC4C
GenAtlas ID CLEC4C
HGNC ID HGNC:13258
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Arce I, Roda-Navarro P, Montoya MC, Hernanz-Falcon P, Puig-Kroger A, Fernandez-Ruiz E: Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells. Eur J Immunol. 2001 Sep;31(9):2733-40. [PubMed:11536172 ]
  4. Dzionek A, Sohma Y, Nagafune J, Cella M, Colonna M, Facchetti F, Gunther G, Johnston I, Lanzavecchia A, Nagasaka T, Okada T, Vermi W, Winkels G, Yamamoto T, Zysk M, Yamaguchi Y, Schmitz J: BDCA-2, a novel plasmacytoid dendritic cell-specific type II C-type lectin, mediates antigen capture and is a potent inhibitor of interferon alpha/beta induction. J Exp Med. 2001 Dec 17;194(12):1823-34. [PubMed:11748283 ]
  5. Fernandes MJ, Iscove NN, Gingras G, Calabretta B: Identification and characterization of the gene for a novel C-type lectin (CLECSF7) that maps near the natural killer gene complex on human chromosome 12. Genomics. 2000 Oct 15;69(2):263-70. [PubMed:11031109 ]