You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07592
Secondary Accession Numbers
  • 13301
Name Calcium-activated chloride channel regulator 2
Synonyms
  1. CaCC-3
  2. Calcium-activated chloride channel family member 2
  3. Calcium-activated chloride channel protein 3
  4. Calcium-activated chloride channel regulator 2, 109 kDa form
  5. Calcium-activated chloride channel regulator 2, 35 kDa form
  6. hCLCA2
  7. hCaCC-3
Gene Name CLCA2
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function Play a role in modulating chloride current across the plasma membrane in a calcium-dependent manner, and cell adhesion. Involved in basal cell adhesion and/or stratification of squamous epithelia. May act as a tumor suppressor in breast and colorectal cancer. Plays a key role for cell adhesion in the beginning stages of lung metastasis via the binding to ITGB4
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Calcium-activated chloride channel regulator 2
  2. 109 kDa form:Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.3
SNPs CLCA2
Gene Sequence
>2832 bp
ATGACCCAAAGGAGCATTGCAGGTCCTATTTGCAACCTGAAGTTTGTGACTCTCCTGGTT
GCCTTAAGTTCAGAACTCCCATTCCTGGGAGCTGGAGTACAGCTTCAAGACAATGGGTAT
AATGGATTGCTCATTGCCATTAATCCTCAGGTACCTGAGAATCAGAACCTCATCTCAAAC
ATTAAGGAAATGATAACTGAAGCTTCATTTTACCTATTTAATGCTACCAAGAGAAGAGTA
TTTTTCAGAAATATAAAGATTTTAATACCTGCCACATGGAAAGCTAATAATAACAGCAAA
ATAAAACAAGAATCATATGAAAAGGCAAATGTCATAGTGACTGACTGGTATGGGGCACAT
GGAGATGATCCATACACCCTACAATACAGAGGGTGTGGAAAAGAGGGAAAATACATTCAT
TTCACACCTAATTTCCTACTGAATGATAACTTAACAGCTGGCTACGGATCACGAGGCCGA
GTGTTTGTCCATGAATGGGCCCACCTCCGTTGGGGTGTGTTCGATGAGTATATCAATGAC
AAACCTTTCTACATAAATGGGCAAAATCAAATTAAAGTGACAAGGTGTTCATCTGACATC
ACAGGCATTTTTGTGTGTGAAAAAGGTCCTTGCCCCCAAGAAAACTGTATTATTAGTAAG
CTTTTTAAAGAAGGATGCACCTTTATCTACAATAGCACCCAAAATGCAACTGCATCAATA
ATGTTCATGCAAAGTTTATCTTCTGTGGTTGAATTTTGTAATGCAAGTACCCACAACCAA
GAAGCACCAAACCTACAGAACCAGATGTGCAGCCTCAGAAGTGCATGGGATGTAATCACA
GACTCTGCTGACTTTCACCACAGCTTTCCCATGAATGGGACTGAGCTTCCACCTCCTCCC
ACATTCTCGCTTGTACAGGCTGGCGACAAAGTGGTCTGTTTAGTGCTGGATGTGTCCAGC
AAGATGGCAGAGGCTGACAGACTCCTTCAACTACAACAAGCCGCAGAATTTTATTTGATG
CAGATTGTTGAAATTCATACCTTCGTGGGCATTGCCAGTTTCGACAGCAAAGGAGAGATC
AGAGCCCAGCTACACCAAATTAACAGCAATGATGATCGAAAGTTGCTGGTTTCATATCTG
CCCACCACTGTATCAGCTAAAACAGACATCAGCATTTGTTCAGGGCTTAAGAAAGGATTT
GAGGTGGTTGAAAAACTGAATGGAAAAGCTTATGGCTCTGTGATGATATTAGTGACCAGC
GGAGATGATAAGCTTCTTGGCAATTGCTTACCCACTGTGCTCAGCAGTGGTTCAACAATT
CACTCCATTGCCCTGGGTTCATCTGCAGCCCCAAATCTGGAGGAATTATCACGTCTTACA
GGAGGTTTAAAGTTCTTTGTTCCAGATATATCAAACTCCAATAGCATGATTGATGCTTTC
AGTAGAATTTCCTCTGGAACTGGAGACATTTTCCAGCAACATATTCAGCTTGAAAGTACA
GGTGAAAATGTCAAACCTCACCATCAATTGAAAAACACAGTGACTGTGGATAATACTGTG
GGCAACGACACTATGTTTCTAGTTACGTGGCAGGCCAGTGGTCCTCCTGAGATTATATTA
TTTGATCCTGATGGACGAAAATACTACACAAATAATTTTATCACCAATCTAACTTTTCGG
ACAGCTAGTCTTTGGATTCCAGGAACAGCTAAGCCTGGGCACTGGACTTACACCCTGAAC
AATACCCATCATTCTCTGCAAGCCCTGAAAGTGACAGTGACCTCTCGCGCCTCCAACTCA
GCTGTGCCCCCAGCCACTGTGGAAGCCTTTGTGGAAAGAGACAGCCTCCATTTTCCTCAT
CCTGTGATGATTTATGCCAATGTGAAACAGGGATTTTATCCCATTCTTAATGCCACTGTC
ACTGCCACAGTTGAGCCAGAGACTGGAGATCCTGTTACGCTGAGACTCCTTGATGATGGA
GCAGGTGCTGATGTTATAAAAAATGATGGAATTTACTCGAGGTATTTTTTCTCCTTTGCT
GCAAATGGTAGATATAGCTTGAAAGTGCATGTCAATCACTCTCCCAGCATAAGCACCCCA
GCCCACTCTATTCCAGGGAGTCATGCTATGTATGTACCAGGTTACACAGCAAACGGTAAT
ATTCAGATGAATGCTCCAAGGAAATCAGTAGGCAGAAATGAGGAGGAGCGAAAGTGGGGC
TTTAGCCGAGTCAGCTCAGGAGGCTCCTTTTCAGTGCTGGGAGTTCCAGCTGGCCCCCAC
CCTGATGTGTTTCCACCATGCAAAATTATTGACCTGGAAGCTGTAAAAGTAGAAGAGGAA
TTGACCCTATCTTGGACAGCACCTGGAGAAGACTTTGATCAGGGCCAGGCTACAAGCTAT
GAAATAAGAATGAGTAAAAGTCTACAGAATATCCAAGATGACTTTAACAATGCTATTTTA
GTAAATACATCAAAGCGAAATCCTCAGCAAGCTGGCATCAGGGAGATATTTACGTTCTCA
CCCCAAATTTCCACGAATGGACCTGAACATCAGCCAAATGGAGAAACACATGAAAGCCAC
AGAATTTATGTTGCAATACGAGCAATGGATAGGAACTCCTTACAGTCTGCTGTATCTAAC
ATTGCCCAGGCGCCTCTGTTTATTCCCCCCAATTCTGATCCTGTACCTGCCAGAGATTAT
CTTATATTGAAAGGAGTTTTAACAGCAATGGGTTTGATAGGAATCATTTGCCTTATTATA
GTTGTGACACATCATACTTTAAGCAGGAAAAAGAGAGCAGACAAGAAAGAGAATGGAACA
AAATTATTATAA
Protein Properties
Number of Residues 943
Molecular Weight 103940.0
Theoretical pI 7.03
Pfam Domain Function
Signals
  • 1-31
Transmembrane Regions
  • 902-922
Protein Sequence
>Calcium-activated chloride channel regulator 2
MTQRSIAGPICNLKFVTLLVALSSELPFLGAGVQLQDNGYNGLLIAINPQVPENQNLISN
IKEMITEASFYLFNATKRRVFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAH
GDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNND
KPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQNATASI
MFMQSLSSVVEFCNASTHNQEAPNLQNQMCSLRSAWDVITDSADFHHSFPMNGTELPPPP
TFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEI
RAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVVEKLNGKAYGSVMILVTS
GDDKLLGNCLPTVLSSGSTIHSIALGSSAAPNLEELSRLTGGLKFFVPDISNSNSMIDAF
SRISSGTGDIFQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPPEIIL
FDPDGRKYYTNNFITNLTFRTASLWIPGTAKPGHWTYTLNNTHHSLQALKVTVTSRASNS
AVPPATVEAFVERDSLHFPHPVMIYANVKQGFYPILNATVTATVEPETGDPVTLRLLDDG
AGADVIKNDGIYSRYFFSFAANGRYSLKVHVNHSPSISTPAHSIPGSHAMYVPGYTANGN
IQMNAPRKSVGRNEEERKWGFSRVSSGGSFSVLGVPAGPHPDVFPPCKIIDLEAVKVEEE
LTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFS
PQISTNGPEHQPNGETHESHRIYVAIRAMDRNSLQSAVSNIAQAPLFIPPNSDPVPARDY
LILKGVLTAMGLIGIICLIIVVTHHTLSRKKRADKKENGTKLL
GenBank ID Protein 4887601
UniProtKB/Swiss-Prot ID Q9UQC9
UniProtKB/Swiss-Prot Entry Name CLCA2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB026833
GeneCard ID CLCA2
GenAtlas ID CLCA2
HGNC ID HGNC:2016
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Gruber AD, Schreur KD, Ji HL, Fuller CM, Pauli BU: Molecular cloning and transmembrane structure of hCLCA2 from human lung, trachea, and mammary gland. Am J Physiol. 1999 Jun;276(6 Pt 1):C1261-70. [PubMed:10362588 ]
  5. Agnel M, Vermat T, Culouscou JM: Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea. FEBS Lett. 1999 Jul 23;455(3):295-301. [PubMed:10437792 ]
  6. Itoh R, Kawamoto S, Miyamoto Y, Kinoshita S, Okubo K: Isolation and characterization of a Ca(2+)-activated chloride channel from human corneal epithelium. Curr Eye Res. 2000 Dec;21(6):918-25. [PubMed:11262615 ]
  7. Gruber AD, Pauli BU: Tumorigenicity of human breast cancer is associated with loss of the Ca2+-activated chloride channel CLCA2. Cancer Res. 1999 Nov 1;59(21):5488-91. [PubMed:10554024 ]
  8. Bustin SA, Li SR, Dorudi S: Expression of the Ca2+-activated chloride channel genes CLCA1 and CLCA2 is downregulated in human colorectal cancer. DNA Cell Biol. 2001 Jun;20(6):331-8. [PubMed:11445004 ]
  9. Abdel-Ghany M, Cheng HC, Elble RC, Pauli BU: The breast cancer beta 4 integrin and endothelial human CLCA2 mediate lung metastasis. J Biol Chem. 2001 Jul 6;276(27):25438-46. Epub 2001 Apr 24. [PubMed:11320086 ]
  10. Connon CJ, Yamasaki K, Kawasaki S, Quantock AJ, Koizumi N, Kinoshita S: Calcium-activated chloride channel-2 in human epithelia. J Histochem Cytochem. 2004 Mar;52(3):415-8. [PubMed:14966209 ]
  11. Connon CJ, Kawasaki S, Yamasaki K, Quantock AJ, Kinoshita S: The quantification of hCLCA2 and colocalisation with integrin beta4 in stratified human epithelia. Acta Histochem. 2005;106(6):421-5. Epub 2005 Jan 11. [PubMed:15707651 ]
  12. Connon CJ, Kawasaki S, Liles M, Koizumi N, Yamasaki K, Nakamura T, Quantock AJ, Kinoshita S: Gene expression and immunolocalisation of a calcium-activated chloride channel during the stratification of cultivated and developing corneal epithelium. Cell Tissue Res. 2006 Jan;323(1):177-82. Epub 2005 Sep 13. [PubMed:16158324 ]
  13. Elble RC, Walia V, Cheng HC, Connon CJ, Mundhenk L, Gruber AD, Pauli BU: The putative chloride channel hCLCA2 has a single C-terminal transmembrane segment. J Biol Chem. 2006 Oct 6;281(40):29448-54. Epub 2006 Jul 27. [PubMed:16873362 ]