You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07598
Secondary Accession Numbers
  • 13307
Name Claudin-15
Synonyms Not Available
Gene Name CLDN15
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.22
SNPs CLDN15
Gene Sequence
>687 bp
ATGTCGATGGCTGTGGAAACCTTTGGCTTCTTCATGGCAACTGTGGGGCTGCTGATGCTG
GGGGTGACTCTGCCAAACAGCTACTGGCGAGTGTCCACTGTGCACGGGAACGTCATCACC
ACCAACACCATCTTCGAGAACCTCTGGTTTAGCTGTGCCACCGACTCCCTGGGCGTCTAC
AACTGCTGGGAGTTCCCGTCCATGCTGGCCCTCTCTGGGTATATTCAGGCCTGCCGGGCA
CTCATGATCACCGCCATCCTCCTGGGCTTCCTCGGCCTCTTGCTAGGCATAGCGGGCCTG
CGCTGCACCAACATTGGGGGCCTGGAGCTCTCCAGGAAAGCCAAGCTGGCGGCCACCGCA
GGGGCCCTCCACATTCTGGCCGGTATCTGCGGGATGGTGGCCATCTCCTGGTACGCCTTC
AACATCACCCGGGACTTCTTCGACCCCTTGTACCCCGGAACCAAGTACGAGCTGGGCCCC
GCCCTCTACCTGGGGTGGAGCGCCTCACTGATCTCCATCCTGGGTGGCCTCTGCCTCTGC
TCCGCCTGCTGCTGCGGCTCTGACGAGGACCCAGCCGCCAGCGCCCGGCGGCCCTACCAG
GCTCCCGTGTCCGTGATGCCCGTCGCCACCTCGGACCAAGAAGGCGACAGCAGCTTTGGC
AAATACGGCAGAAACGCCTACGTGTAG
Protein Properties
Number of Residues 228
Molecular Weight 24356.0
Theoretical pI 5.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 4-24
  • 80-100
  • 120-140
  • 158-178
Protein Sequence
>Claudin-15
MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY
NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC
SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
GenBank ID Protein 5731817
UniProtKB/Swiss-Prot ID P56746
UniProtKB/Swiss-Prot Entry Name CLD15_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ245738
GeneCard ID CLDN15
GenAtlas ID CLDN15
HGNC ID HGNC:2036
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]