You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07600
Secondary Accession Numbers
  • 13309
Name Claudin-17
Synonyms Not Available
Gene Name CLDN17
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:2
Locus 21q22.11
SNPs CLDN17
Gene Sequence
>675 bp
ATGGCATTTTATCCCTTGCAAATTGCTGGGCTGGTTCTTGGGTTCCTTGGCATGGTGGGG
ACTCTTGCCACAACCCTTCTGCCTCAGTGGAGAGTATCAGCTTTTGTTGGCAGCAACATT
ATTGTCTTTGAGAGGCTCTGGGAAGGGCTCTGGATGAATTGCATCCGACAAGCCAGGGTC
CGGTTGCAATGCAAGTTCTATAGCTCCTTGTTGGCTCTCCCGCCTGCCCTGGAAACAGCC
CGGGCCCTCATGTGTGTGGCTGTTGCTCTCTCCTTGATCGCCCTGCTTATTGGCATCTGT
GGCATGAAGCAGGTCCAGTGCACAGGCTCTAACGAGAGGGCCAAAGCATACCTTCTGGGA
ACTTCAGGAGTCCTCTTCATCCTGACGGGCATCTTCGTTCTGATTCCGGTGAGCTGGACA
GCCAATATAATCATCAGAGATTTCTACAACCCAGCCATCCACATAGGTCAGAAACGAGAG
CTGGGAGCAGCACTTTTCCTTGGCTGGGCAAGCGCTGCTGTCCTCTTCATTGGAGGGGGT
CTGCTTTGTGGATTTTGCTGCTGCAACAGAAAGAAGCAAGGGTACAGATATCCAGTGCCT
GGCTACCGTGTGCCACACACAGATAAGCGAAGAAATACGACAATGCTTAGTAAGACCTCC
ACCAGTTATGTCTAA
Protein Properties
Number of Residues 224
Molecular Weight 24603.1
Theoretical pI 10.08
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 8-28
  • 82-102
  • 125-145
  • 165-185
Protein Sequence
>Claudin-17
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARV
RLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLG
TSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGG
LLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
GenBank ID Protein 6433862
UniProtKB/Swiss-Prot ID P56750
UniProtKB/Swiss-Prot Entry Name CLD17_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ250712
GeneCard ID CLDN17
GenAtlas ID CLDN17
HGNC ID HGNC:2038
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]