You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07605
Secondary Accession Numbers
  • 13314
Name Claudin-22
Synonyms Not Available
Gene Name CLDN22
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell-cell junction
occluding junction
tight junction
membrane
cell part
membrane part
plasma membrane part
cell junction
Function
structural molecule activity
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:4
Locus 4q35.1
SNPs CLDN22
Gene Sequence
>663 bp
ATGGCTTTAGTATTTAGAACTGTAGCTCAACTAGCTGGAGTTTCATTATCTTTGCTGGGA
TGGGTTTTATCCTGTCTTACAAACTACCTGCCACACTGGAAGAACCTCAACCTGGACTTA
AATGAAATGGAAAACTGGACCATGGGACTCTGGCAAACCTGTGTCATCCAAGAGGAAGTG
GGGATGCAATGCAAGGACTTTGACTCCTTCCTGGCTTTGCCTGCTGAACTCAGGGTCTCC
AGGATCTTAATGTTTCTGTCAAATGGGCTGGGATTTCTGGGCCTGCTGGTCTCTGGGTTT
GGCCTGGACTGTTTGAGAATTGGAGAGAGTCAGAGAGATCTCAAGAGGCGACTGCTGATC
CTGGGAGGAATTCTGTCCTGGGCCTCGGGAGTCACAGCCCTGGTTCCCGTCTCTTGGGTT
GCCCACAAGACGGTTCAGGAGTTCTGGGATGAGAACGTCCCAGACTTTGTCCCCAGGTGG
GAGTTTGGGGAGGCCCTGTTTCTGGGCTGGTTTGCTGGACTTTCTCTTCTGCTAGGAGGG
TGTCTGCTCCACTGTGCAGCCTGCTCCAGCCACGCTCCCCTAGCTTCGGGCCACTACGCA
GTGGCACAAACACAAGATCATCATCAAGAACTGGAGACGAGAAACACCAACCTGAAACAC
TAA
Protein Properties
Number of Residues 220
Molecular Weight 24509.2
Theoretical pI 6.07
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 11-30
  • 82-102
  • 118-138
  • 165-185
Protein Sequence
>Claudin-22
MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH
GenBank ID Protein 162417973
UniProtKB/Swiss-Prot ID Q8N7P3
UniProtKB/Swiss-Prot Entry Name CLD22_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001111319.1
GeneCard ID CLDN22
GenAtlas ID CLDN22
HGNC ID HGNC:2044
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]