You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07611
Secondary Accession Numbers
  • 13320
Name Calmegin
Synonyms Not Available
Gene Name CLGN
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Probably plays an important role in spermatogenesis. Binds calcium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
endoplasmic reticulum
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
ion binding
cation binding
metal ion binding
binding
unfolded protein binding
protein binding
calcium ion binding
Process
metabolic process
macromolecule metabolic process
cellular protein metabolic process
protein folding
protein metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q28.3-q31.1
SNPs CLGN
Gene Sequence
>1833 bp
ATGCATTTCCAAGCCTTTTGGCTATGTTTGGGTCTTCTGTTCATCTCAATTAATGCAGAA
TTTATGGATGATGATGTTGAGACGGAAGACTTTGAAGAAAATTCAGAAGAAATTGATGTT
AATGAAAGTGAACTTTCCTCAGAGATTAAATATAAGACACCTCAACCTATAGGAGAAGTA
TATTTTGCAGAAACTTTTGATAGTGGAAGGTTGGCTGGATGGGTCTTATCAAAAGCAAAG
AAAGATGACATGGATGAGGAAATTTCAATATACGATGGAAGATGGGAAATTGAAGAGTTG
AAAGAAAACCAGGTACCTGGTGACAGAGGACTGGTATTAAAATCTAGAGCAAAGCATCAT
GCAATATCTGCTGTATTAGCAAAACCATTCATTTTTGCTGATAAACCCTTGATAGTTCAA
TATGAAGTAAATTTTCAAGATGGTATTGATTGTGGAGGTGCATACATTAAACTCCTAGCA
GACACCGATGATTTGATTCTGGAAAACTTTTATGATAAAACATCCTATATCATTATGTTT
GGACCAGATAAATGTGGAGAAGATTATAAACTTCATTTTATCTTCAGACATAAACATCCC
AAAACTGGAGTTTTCGAAGAGAAACATGCCAAACCTCCAGATGTAGACCTTAAAAAGTTC
TTTACAGACAGGAAGACTCATCTTTATACCCTTGTGATGAATCCAGATGACACATTTGAG
GTGTTAGTTGATCAAACAGTTGTAAACAAAGGAAGCCTCCTAGAGGATGTGGTTCCTCCT
ATCAAACCTCCCAAAGAAATTGAAGATCCCAATGATAAAAAACCTGAGGAATGGGATGAA
AGAGCAAAAATTCCTGATCCTTCTGCCGTCAAACCAGAAGACTGGGATGAAAGTGAACCT
GCCCAAATAGAAGATTCAAGTGTTGTTAAACCTGCTGGCTGGCTTGATGATGAACCAAAA
TTTATCCCTGATCCTAATGCTGAAAAACCTGATGACTGGAATGAAGACACGGATGGAGAA
TGGGAGGCACCTCAGATTCTTAATCCAGCATGTCGGATTGGGTGTGGTGAGTGGAAACCT
CCCATGATAGATAACCCAAAATACAAAGGAGTATGGAGACCTCCACTGGTCGATAATCCT
AACTATCAGGGAATCTGGAGTCCTCGAAAAATTCCTAATCCAGATTATTTCGAAGATGAT
CATCCATTTCTTCTGACTTCTTTCAGTGCTCTTGGTTTAGAGCTTTGGTCTATGACCTCT
GATATCTACTTTGATAATTTTATTATCTGTTCGGAAAAGGAAGTAGCAGATCACTGGGCT
GCAGATGGTTGGAGATGGAAAATAATGATAGCAAATGCTAATAAGCCTGGTGTATTAAAA
CAGTTAATGGCAGCTGCTGAAGGGCACCCATGGCTTTGGTTGATTTATCTTGTGACAGCA
GGAGTGCCAATAGCATTAATTACTTCATTTTGTTGGCCAAGAAAAGTAAAGAAAAAACAT
AAAGATACAGAGTATAAAAAAACCGACATATGTATACCACAAACAAAAGGAGTACTAGAG
CAAGAAGAAAAGGAAGAGAAAGCAGCCCTGGAAAAACCAATGGACCTGGAAGAGGAAAAA
AAGCAAAATGATGGTGAAATGCTTGAAAAAGAAGAGGAAAGTGAACCTGAGGAAAAGAGT
GAAGAAGAAATTGAAATCATAGAAGGGCAAGAAGAAAGTAATCAATCAAATAAGTCTGGG
TCAGAGGATGAGATGAAAGAAGCAGATGAGAGCACAGGATCTGGAGATGGGCCGATAAAG
TCAGTACGCAAAAGAAGAGTACGAAAGGACTAA
Protein Properties
Number of Residues 610
Molecular Weight 70038.0
Theoretical pI 4.3
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • 472-492
Protein Sequence
>Calmegin
MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
AISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
VLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEP
AQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKP
PMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
DIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTA
GVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEK
KQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIK
SVRKRRVRKD
GenBank ID Protein 193787446
UniProtKB/Swiss-Prot ID O14967
UniProtKB/Swiss-Prot Entry Name CLGN_HUMAN
PDB IDs Not Available
GenBank Gene ID AK093096
GeneCard ID CLGN
GenAtlas ID CLGN
HGNC ID HGNC:2060
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Tanaka H, Ikawa M, Tsuchida J, Nozaki M, Suzuki M, Fujiwara T, Okabe M, Nishimune Y: Cloning and characterization of the human Calmegin gene encoding putative testis-specific chaperone. Gene. 1997 Dec 19;204(1-2):159-63. [PubMed:9434179 ]
  5. van Lith M, Karala AR, Bown D, Gatehouse JA, Ruddock LW, Saunders PT, Benham AM: A developmentally regulated chaperone complex for the endoplasmic reticulum of male haploid germ cells. Mol Biol Cell. 2007 Aug;18(8):2795-804. Epub 2007 May 16. [PubMed:17507649 ]