You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07613
Secondary Accession Numbers
  • 13322
Name Clathrin heavy chain 2
Synonyms
  1. CLH-22
  2. Clathrin heavy chain on chromosome 22
Gene Name CLTCL1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
clathrin coat of coated pit
clathrin coat
clathrin vesicle coat
clathrin coat of trans-golgi network vesicle
macromolecular complex
protein complex
Function
binding
structural molecule activity
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Membrane
  4. Cytoplasmic side
  5. Cytoplasmic side
  6. Cytoplasmic vesicle membrane
  7. coated pit
Gene Properties
Chromosome Location Chromosome:2
Locus 22q11.2|22q11.21
SNPs CLTCL1
Gene Sequence
>4923 bp
ATGGCGCAGATCCTCCCTGTTCGCTTTCAGGAGCACTTCCAGCTCCAAAACCTTGGAATT
AATCCAGCTAACATTGGATTCAGCACACTGACCATGGAATCTGACAAGTTCATATGTATC
CGAGAGAAAGTTGGTGAGCAGGCACAGGTCACGATCATTGACATGAGTGACCCAATGGCT
CCGATCCGACGGCCTATCTCTGCAGAGAGTGCCATCATGAATCCAGCCTCTAAGGTGATA
GCTCTGAAAGCTGGGAAGACACTTCAGATCTTTAATATTGAGATGAAGAGTAAAATGAAG
GCTCATACTATGGCAGAAGAAGTGATTTTCTGGAAATGGGTTTCTGTGAACACTGTTGCC
TTGGTGACCGAGACCGCGGTCTACCACTGGAGCATGGAAGGTGACTCCCAGCCCATGAAG
ATGTTTGATAGACATACCAGTCTGGTGGGCTGCCAGGTGATTCACTACCGGACTGATGAG
TACCAGAAGTGGCTGCTGCTCGTAGGCATCTCGGCTCAGCAAAACCGTGTGGTTGGAGCA
ATGCAGCTCTACTCTGTGGATAGGAAGGTTTCACAACCCATAGAAGGCCATGCTGCGGCT
TTTGCAGAGTTCAAGATGGAGGGGAATGCCAAGCCTGCCACCCTTTTCTGCTTTGCTGTA
CGTAATCCCACAGGAGGCAAGTTGCACATCATTGAAGTTGGACAGCCTGCAGCGGGAAAC
CAACCTTTTGTAAAGAAAGCAGTAGATGTGTTTTTTCCTCCAGAGGCACAGAATGATTTT
CCAGTGGCTATGCAGATTGGAGCTAAACATGGTGTTATTTACTTGATCACAAAGTATGGC
TATCTTCATCTGTACGACCTAGAGTCTGGCGTGTGCATCTGCATGAACCGTATTAGTGCT
GACACAATATTTGTCACTGCTCCACACAAACCAACCTCTGGAATTATTGGTGTCAACAAA
AAGGGACAGGTACTGTCAGTTTGTGTTGAGGAAGATAACATTGTGAATTATGCAACCAAC
GTGCTTCAGAATCCAGACCTTGGTCTGCGTTTGGCCGTTCGTAGTAACCTGGCTGGGGCA
GAGAAGTTGTTTGTGAGAAAATTCAATACCCTCTTTGCACAGGGCAGCTATGCTGAAGCC
GCCAAAGTTGCAGCGTCTGCACCAAAGGGAATCCTGCGTACCAGAGAGACGGTCCAGAAA
TTCCAGAGTATACCCGCTCAGTCTGGCCAGGCTTCTCCATTGCTGCAGTACTTCGGAATC
CTGCTCGACCAGGGTCAGCTCAATAAACTTGAATCCTTAGAACTTTGCCATCTGGTTCTT
CAGCAGGGGCGTAAGCAACTCCTAGAGAAGTGGCTGAAAGAAGATAAGCTGGAGTGCTCA
GAGGAGCTCGGAGACTTGGTCAAAACCACTGACCCCATGCTCGCTCTGAGTGTGTACCTT
CGGGCAAATGTGCCAAGCAAAGTGATCCAGTGTTTTGCAGAAACAGGCCAATTCCAGAAA
ATTGTGCTCTATGCCAAAAAGGTTGGGTACACCCCAGACTGGATCTTTCTGCTGAGGGGT
GTAATGAAGATCAGTCCGGAACAGGGCCTGCAGTTTTCTCGAATGCTAGTGCAGGACGAG
GAGCCGCTGGCCAACATTAGCCAGATTGTGGACATTTTCATGGAAAACAGTTTAATTCAG
CAGTGTACTTCCTTCTTATTGGATGCCTTGAAGAATAATCGCCCAGCTGAGGGACTCCTG
CAGACATGGCTGTTGGAGATGAACCTTGTTCATGCACCCCAGGTTGCAGATGCCATCCTT
GGAAATAAAATGTTTACTCATTACGACCGGGCCCACATTGCCCAGCTCTGTGAGAAGGCA
GGCCTCCTGCAGCAAGCACTGGAGCACTACACCGACCTCTATGACATCAAGAGGGCTGTG
GTCCACACTCACCTCCTCAATCCCGAGTGGCTTGTCAATTTCTTTGGCTCCTTATCGGTG
GAGGATTCTGTGGAGTGTCTGCATGCCATGCTGTCTGCTAACATCAGACAGAACCTTCAG
CTGTGTGTGCAGGTGGCCTCTAAGTACCACGAGCAGCTGGGCACGCAGGCCCTGGTGGAG
CTCTTTGAATCCTTCAAGAGTTACAAAGGCCTCTTCTACTTCCTGGGCTCAATCGTGAAC
TTCAGCCAAGACCCAGATGTGCATCTGAAATACATTCAGGCTGCCTGTAAGACAGGGCAG
ATCAAGGAGGTGGAGAGGATATGCCGAGAGAGCAGCTGCTACAACCCAGAGCGTGTGAAG
AACTTCCTGAAGGAGGCCAAGCTCACAGACCAGCTTCCCCTCATCATCGTGTGTGATCGT
TTTGGCTTTGTCCATGACCTTGTCCTATATTTATACCGCAACAACCTGCAGAGGTACATT
GAGATCTACGTGCAGAAGGTCAACCCTAGCCGGACCCCAGCTGTGATTGGAGGGCTGCTT
GATGTGGATTGTTCTGAGGAAGTGATTAAACACTTAATCATGGCAGTGAGAGGACAGTTC
TCTACTGATGAGTTGGTGGCTGAAGTAGAAAAAAGAAATAGGCTCAAGCTGCTGCTTCCC
TGGCTGGAGTCCCAGATTCAGGAAGGCTGTGAGGAGCCTGCCACTCACAATGCACTGGCT
AAAATCTACATCGACAGCAACAACAGCCCCGAGTGCTTCCTGAGAGAGAATGCCTACTAT
GACAGCAGCGTGGTGGGCCGCTACTGTGAGAAGCGAGACCCCCATCTGGCCTGTGTTGCC
TATGAGCGGGGGCAGTGTGACCTTGAGCTCATCAAGGTGTGCAATGAGAATTCTCTGTTC
AAAAGCGAGGCCCGCTACCTGGTATGCAGAAAGGATCCGGAGCTCTGGGCTCACGTCCTT
GAGGAGACCAACCCATCCAGGAGACAGCTAATTGACCAGGTGGTACAGACAGCATTGTCA
GAAACACGGGATCCTGAAGAGATTTCGGTCACTGTCAAAGCCTTTATGACAGCCGACCTG
CCTAATGAACTGATTGAACTGCTGGAGAAGATAGTTCTGGATAACTCTGTCTTCAGCGAG
CACAGGAATCTACAGAATCTGTTGATCCTGACTGCCATCAAGGCAGACCGCACACGGGTC
ATGGAGTACATCAGCCGCCTGGACAACTATGACGCACTGGACATCGCGAGCATCGCTGTC
AGCAGCGCACTGTATGAGGAGGCCTTCACCGTTTTCCACAAGTTTGATATGAATGCCTCA
GCAATCCAGGTCCTGATCGAGCACATTGGAAACCTGGACCGGGCATATGAGTTTGCGGAG
AGATGCAATGAGCCTGCTGTGTGGAGTCAGCTGGCCCAAGCCCAGCTCCAGAAAGATTTG
GTGAAGGAAGCCATCAACTCCTATATCAGAGGGGACGACCCTTCCTCTTACCTGGAAGTT
GTTCAGTCAGCCAGCAGGAGCAACAACTGGGAGGATCTAGTTAAATTTCTGCAGATGGCC
AGGAAAAAGGGCCGTGAGTCCTATATAGAGACTGAACTTATTTTTGCCTTGGCTAAAACC
AGCCGTGTTTCTGAGCTAGAAGATTTTATTAATGGACCCAACAATGCCCACATCCAGCAG
GTTGGAGACCGCTGTTACGAGGAGGGAATGTACGAGGCTGCCAAGCTGCTCTATAGCAAT
GTTTCTAACTTTGCCCGCCTGGCTTCCACCTTGGTTCACCTCGGTGAGTATCAGGCAGCA
GTGGACAACAGCCGCAAGGCCAGCAGCACCCGGACGTGGAAGGAGGTGTGCTTTGCCTGC
ATGGATGGACAAGAGTTCCGCTTCGCACAGCTGTGTGGTCTTCACATCGTCATTCATGCA
GATGAGCTGGAGGAGCTGATGTGCTATTACCAGGATCGTGGCTACTTTGAGGAGCTGATC
TTGCTGTTGGAAGCGGCCCTGGGCCTGGAGCGGGCCCACATGGGCATGTTCACTGAGCTG
GCCATCCTCTACTCCAAATTCAAGCCACAGAAGATGCTGGAGCATCTGGAGCTTTTCTGG
TCCCGTGTCAACATCCCAAAGGTGCTGAGGGCTGCAGAGCAGGCACACCTGTGGGCTGAG
CTGGTGTTCCTCTATGACAAGTACGAGGAGTATGACAATGCTGTGCTCACCATGATGAGC
CACCCCACTGAGGCCTGGAAGGAGGGTCAGTTCAAGGACATCATTACCAAGGTTGCCAAC
GTCGAGCTCTGTTACAGAGCCCTGCAGTTCTATTTGGATTACAAACCACTGCTCATCAAT
GACCTGCTGCTGGTGCTTTCACCCCGGCTGGACCACACCTGGACAGTCAGTTTCTTTTCA
AAGGCAGGTCAGCTGCCCCTGGTGAAGCCTTACCTGCGGTCAGTCCAGAGCCACAACAAC
AAGAGTGTGAATGAGGCACTCAACCACCTGCTGACAGAGGAGGAGGACTATCAGGGCTTA
AGGGCATCTATCGATGCCTATGACAACTTTGACAACATCAGCCTGGCTCAGCAGCTGGAG
AAGCATCAGCTGATGGAGTTCAGGTGCATTGCGGCCTATCTGTACAAGGGCAATAACTGG
TGGGCCCAGAGCGTGGAGCTCTGCAAGAAGGATCATCTCTACAAGGATGCCATGCAGCAT
GCTGCAGAGTCGCGGGATGCTGAGCTGGCCCAGAAGTTGCTGCAGTGGTTCCTGGAGGAA
GGCAAGAGGGAGTGCTTCGCAGCTTGTCTCTTCACCTGCTATGACCTGCTTCGCCCAGAC
ATGGTGCTTGAGCTGGCCTGGAGGCACAACCTCGTGGACTTGGCCATGCCCTACTTCATC
CAGGTGATGAGGGAGTACCTGAGCAAGGTGGACAAACTGGATGCCTTGGAGAGTCTGCGC
AAGCAAGAGGAGCATGTGACAGAGCCTGCCCCTCTCGTGTTTGATTTTGATGGGCATGAA
TGA
Protein Properties
Number of Residues 1640
Molecular Weight 187028.2
Theoretical pI 5.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Clathrin heavy chain 2
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLE
KHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLVFDFDGHE
GenBank ID Protein 242246985
UniProtKB/Swiss-Prot ID P53675
UniProtKB/Swiss-Prot Entry Name CLH2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007098.3
GeneCard ID CLTCL1
GenAtlas ID CLTCL1
HGNC ID HGNC:2093
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Sirotkin H, Morrow B, DasGupta R, Goldberg R, Patanjali SR, Shi G, Cannizzaro L, Shprintzen R, Weissman SM, Kucherlapati R: Isolation of a new clathrin heavy chain gene with muscle-specific expression from the region commonly deleted in velo-cardio-facial syndrome. Hum Mol Genet. 1996 May;5(5):617-24. [PubMed:8733128 ]
  6. Kedra D, Peyrard M, Fransson I, Collins JE, Dunham I, Roe BA, Dumanski JP: Characterization of a second human clathrin heavy chain polypeptide gene (CLH-22) from chromosome 22q11. Hum Mol Genet. 1996 May;5(5):625-31. [PubMed:8733129 ]
  7. Long KR, Trofatter JA, Ramesh V, McCormick MK, Buckler AJ: Cloning and characterization of a novel human clathrin heavy chain gene (CLTCL). Genomics. 1996 Aug 1;35(3):466-72. [PubMed:8844170 ]