Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07618
Secondary Accession Numbers
  • 13327
Name Collectin-12
Synonyms
  1. CL-P1
  2. Collectin placenta protein 1
  3. Nurse cell scavenger receptor 2
  4. Scavenger receptor class A member 4
  5. Scavenger receptor with C-type lectin
  6. hCL-P1
Gene Name COLEC12
Protein Type Unknown
Biological Properties
General Function Involved in sugar binding
Specific Function Scavenger receptor that displays several functions associated with host defense. Promotes binding and phagocytosis of Gram-positive, Gram-negative bacteria and yeast. Mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. Binds to several carbohydrates including Gal-type ligands, D-galactose, L- and D-fucose, GalNAc, T and Tn antigens in a calcium-dependent manner and internalizes specifically GalNAc in nurse-like cells. Binds also to sialyl Lewis X or a trisaccharide and asialo-orosomucoid (ASOR). May also play a role in the clearance of amyloid beta in Alzheimer disease
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
carbohydrate binding
sugar binding
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 18pter-p11.3
SNPs COLEC12
Gene Sequence
>2229 bp
ATGAAAGACGACTTCGCAGAGGAGGAGGAGGTGCAATCCTTCGGTTACAAGCGGTTTGGT
ATTCAGGAAGGAACACAATGTACCAAATGTAAAAATAACTGGGCACTGAAGTTTTCTATC
ATATTATTATACATTTTGTGTGCCTTGCTAACAATCACAGTAGCCATTTTGGGATATAAA
GTTGTAGAGAAAATGGACAATGTCACAGGTGGCATGGAAACATCTCGCCAAACCTATGAT
GACAAGCTCACAGCAGTGGAAAGTGACCTGAAAAAATTAGGTGACCAAACTGGGAAGAAA
GCTATCAGCACCAACTCAGAACTCTCCACCTTCAGATCAGACATTCTAGATCTCCGTCAG
CAACTTCGTGAGATTACAGAAAAAACCAGCAAGAACAAGGATACGCTGGAGAAGTTACAG
GCGAGCGGGGATGCTCTGGTGGACAGGCAGAGTCAATTGAAAGAAACTTTGGAGAATAAC
TCTTTCCTCATCACCACTGTAAACAAAACCCTCCAGGCGTATAATGGCTATGTCACGAAT
CTGCAGCAAGATACCAGCGTGCTCCAGGGCAATCTGCAGAACCAAATGTATTCTCATAAT
GTGGTCATCATGAACCTCAACAACCTGAACCTGACCCAGGTGCAGCAGAGGAACCTCATC
ACGAATCTGCAGCGGTCTGTGGATGACACAAGCCAGGCTATCCAGCGAATCAAGAACGAC
TTTCAAAATCTGCAGCAGGTTTTTCTTCAAGCCAAGAAGGACACGGATTGGCTGAAGGAG
AAAGTGCAGAGCTTGCAGACGCTGGCTGCCAACAACTCTGCGTTGGCCAAAGCCAACAAC
GACACCCTGGAGGATATGAACAGCCAGCTCAACTCATTCACAGGTCAGATGGAGAACATC
ACCACTATCTCTCAAGCCAACGAGCAGAACCTGAAAGACCTGCAGGACTTACACAAAGAT
GCAGAGAATAGAACAGCCATCAAGTTCAACCAACTGGAGGAACGCTTCCAGCTCTTTGAG
ACGGATATTGTGAACATCATTAGCAATATCAGTTACACAGCCCACCACCTGCGGACGCTG
ACCAGCAATCTAAATGAAGTCAGGACCACTTGCACAGATACCCTTACCAAACACACAGAT
GATCTGACCTCCTTGAATAATACCCTGGCCAACATCCGTTTGGATTCTGTTTCTCTCAGG
ATGCAACAAGATTTGATGAGGTCGAGGTTAGACACTGAAGTAGCCAACTTATCAGTGATT
ATGGAAGAAATGAAGCTAGTAGACTCCAAGCATGGTCAGCTCATCAAGAATTTTACAATA
CTACAAGGTCCACCGGGCCCCAGGGGTCCAAGAGGTGACAGAGGATCCCAGGGACCCCCT
GGCCCAACTGGCAACAAGGGACAGAAAGGAGAGAAGGGGGAGCCTGGACCACCTGGCCCT
GCGGGTGAGAGAGGCCCAATTGGACCAGCTGGTCCCCCCGGAGAGCGTGGCGGCAAAGGA
TCTAAAGGCTCCCAGGGCCCCAAAGGCTCCCGTGGTTCCCCTGGGAAGCCCGGCCCTCAG
GGCCCCAGTGGGGACCCAGGCCCCCCGGGCCCACCAGGCAAAGAGGGACTCCCCGGCCCT
CAGGGCCCTCCTGGCTTCCAGGGACTTCAGGGCACCGTTGGGGAGCCTGGGGTGCCTGGA
CCTCGGGGACTGCCAGGCTTGCCTGGGGTACCAGGCATGCCAGGCCCCAAGGGCCCCCCC
GGCCCTCCTGGCCCATCAGGAGCGGTGGTGCCCCTGGCCCTGCAGAATGAGCCAACCCCG
GCACCGGAGGACAATGGCTGCCCGCCTCACTGGAAGAACTTCACAGACAAATGCTACTAT
TTTTCAGTTGAGAAAGAAATTTTTGAGGATGCAAAGCTTTTCTGTGAAGACAAGTCTTCA
CATCTTGTTTTCATAAACACTAGAGAGGAACAGCAATGGATAAAAAAACAGATGGTAGGG
AGAGAGAGCCACTGGATCGGCCTCACAGACTCAGAGCGTGAAAATGAATGGAAGTGGCTG
GATGGGACATCTCCAGACTACAAAAATTGGAAAGCTGGACAGCCGGATAACTGGGGTCAT
GGCCATGGGCCAGGAGAAGACTGTGCTGGGTTGATTTATGCTGGGCAGTGGAACGATTTC
CAATGTGAAGACGTCAATAACTTCATTTGCGAAAAAGACAGGGAGACAGTACTGTCATCT
GCATTATAA
Protein Properties
Number of Residues 742
Molecular Weight 81514.7
Theoretical pI 5.39
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 38-58
Protein Sequence
>Collectin-12
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVG
RESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDVNNFICEKDRETVLSSAL
GenBank ID Protein 17026101
UniProtKB/Swiss-Prot ID Q5KU26
UniProtKB/Swiss-Prot Entry Name COL12_HUMAN
PDB IDs Not Available
GenBank Gene ID AB005145
GeneCard ID COLEC12
GenAtlas ID COLEC12
HGNC ID HGNC:16016
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  4. Nakamura K, Funakoshi H, Miyamoto K, Tokunaga F, Nakamura T: Molecular cloning and functional characterization of a human scavenger receptor with C-type lectin (SRCL), a novel member of a scavenger receptor family. Biochem Biophys Res Commun. 2001 Feb 2;280(4):1028-35. [PubMed:11162630 ]
  5. Ohtani K, Suzuki Y, Eda S, Kawai T, Kase T, Keshi H, Sakai Y, Fukuoh A, Sakamoto T, Itabe H, Suzutani T, Ogasawara M, Yoshida I, Wakamiya N: The membrane-type collectin CL-P1 is a scavenger receptor on vascular endothelial cells. J Biol Chem. 2001 Nov 23;276(47):44222-8. Epub 2001 Sep 19. [PubMed:11564734 ]
  6. Yoshida T, Tsuruta Y, Iwasaki M, Yamane S, Ochi T, Suzuki R: SRCL/CL-P1 recognizes GalNAc and a carcinoma-associated antigen, Tn antigen. J Biochem. 2003 Mar;133(3):271-7. [PubMed:12761161 ]
  7. Ohmori H, Makita Y, Funamizu M, Chiba S, Ohtani K, Suzuki Y, Wakamiya N, Hata A: Haplotype analysis of the human collectin placenta 1 (hCL-P1) gene. J Hum Genet. 2003;48(2):82-5. [PubMed:12601552 ]
  8. Coombs PJ, Graham SA, Drickamer K, Taylor ME: Selective binding of the scavenger receptor C-type lectin to Lewisx trisaccharide and related glycan ligands. J Biol Chem. 2005 Jun 17;280(24):22993-9. Epub 2005 Apr 21. [PubMed:15845541 ]
  9. Nakamura K, Ohya W, Funakoshi H, Sakaguchi G, Kato A, Takeda M, Kudo T, Nakamura T: Possible role of scavenger receptor SRCL in the clearance of amyloid-beta in Alzheimer's disease. J Neurosci Res. 2006 Sep;84(4):874-90. [PubMed:16868960 ]
  10. Feinberg H, Taylor ME, Weis WI: Scavenger receptor C-type lectin binds to the leukocyte cell surface glycan Lewis(x) by a novel mechanism. J Biol Chem. 2007 Jun 8;282(23):17250-8. Epub 2007 Apr 9. [PubMed:17420244 ]