Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07624
Secondary Accession Numbers
  • 13333
Name Copine-6
Synonyms
  1. Copine VI
  2. N-copine
  3. Neuronal-copine
Gene Name CPNE6
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function May function in membrane trafficking. Exhibits calcium- dependent phospholipid binding properties. May have a role in synaptic plasticity
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 14q11.2
SNPs CPNE6
Gene Sequence
>1674 bp
ATGTCGGACCCTGAGATGGGATGGGTGCCTGAGCCCCCAACCATGACGCTGGGGGCCTCT
CGGGTGGAGCTGCGGGTGTCCTGCCATGGCCTCCTGGACCGGGACACACTCACCAAACCC
CACCCCTGCGTGCTGCTCAAGCTCTACTCTGATGAGCAGTGGGTGGAGGTAGAGCGCACA
GAGGTGCTTCGCTCCTGTTCCAGCCCTGTCTTCTCCCGGGTGCTGGCCCTTGAGTATTTT
TTTGAGGAGAAGCAGCCCCTGCAGTTCCACGTGTTCGATGCCGAGGACGGAGCCACCAGC
CCCCGAAATGATACCTTCCTCGGCTCTACGGAGTGCACCTTGGGCCAGATTGTGTCACAA
ACCAAGGTCACTAAGCCATTATTGCTGAAGAATGGGAAGACTGCGGGCAAGTCCACCATC
ACGATCGTGGCCGAGGAGGTATCAGGCACAAACGACTATGTGCAACTCACCTTCAGAGCC
TACAAGCTGGACAACAAGGATCTGTTCAGCAAGTCTGACCCTTTCATGGAAATCTATAAG
ACCAACGAGGACCAAAGTGATCAGCTGGTCTGGAGAACTGAGGTGGTGAAGAACAACCTG
AACCCCAGCTGGGAGCCGTTCCGCCTGTCCCTGCATTCCCTATGCAGCTGTGATGTTCAC
CGACCTCTCAAGTTCCTGGTGTATGACTATGACTCCAGTGGGAAGCATGACTTCATCGGC
GAGTTCACCAGCACTTTCCAGGAGATGCAGGAAGGGACGGCAAACCCTGGGCAGGAGATG
CAGTGGGACTGTATCAACCCCAAGTATCGGGACAAGAAGAAGAATTACAAGAGCTCAGGG
ACGGTAGTGCTGGCCCAGTGCACGGTGGAGAAGGTGCACACCTTCCTGGATTACATCATG
GGTGGCTGCCAGATCAGCTTCACGGTGGCCATTGACTTCACTGCCTCCAATGGGGACCCG
AGGAGCAGCCAGTCCCTGCACTGCCTCAGTCCCCGACAGCCCAACCACTACCTGCAGGCC
CTGCGTGCAGTGGGAGGCATCTGCCAGGACTATGACAGTGATAAGCGGTTCCCAGCTTTT
GGCTTTGGGGCTCGAATCCCCCCCAACTTCGAGGTGTCCCATGACTTTGCTATCAACTTT
GACCCGGAAAATCCTGAATGTGAAGAGATCTCAGGGGTCATCGCCTCCTACCGTCGTTGC
CTGCCCCAGATCCAGCTCTACGGCCCCACCAATGTGGCCCCCATCATCAACCGTGTGGCT
GAGCCGGCCCAGCGGGAGCAGAGCACCGGCCAAGCCACGAAGTACTCGGTGCTGCTGGTG
CTAACTGACGGTGTGGTGAGCGACATGGCTGAGACTCGCACTGCTATCGTGCGTGCCTCC
CGCCTGCCCATGTCCATCATCATCGTAGGCGTGGGCAATGCTGACTTCTCTGACATGCGG
CTGCTGGATGGCGACGACGGCCCCTTGCGCTGCCCCCGAGGGGTGCCTGCAGCCCGAGAC
ATTGTCCAGTTCGTGCCCTTCCGAGACTTCAAGGATGCTGCCCCCTCTGCACTCGCCAAG
TGTGTCCTGGCTGAGGTGCCACGGCAGGTGGTGGAGTACTACGCCAGCCAGGGCATCAGC
CCTGGGGCTCCCAGGCCCTGCACACTGGCTACGACTCCCAGCCCTAGCCCGTGA
Protein Properties
Number of Residues 557
Molecular Weight 61990.6
Theoretical pI 5.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Copine-6
MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERT
EVLRSCSSPVFSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQ
TKVTKPLLLKNGKTAGKSTITIVAEEVSGTNDYVQLTFRAYKLDNKDLFSKSDPFMEIYK
TNEDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKFLVYDYDSSGKHDFIG
EFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIM
GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAF
GFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA
EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMR
LLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGIS
PGAPRPCTLATTPSPSP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95741
UniProtKB/Swiss-Prot Entry Name CPNE6_HUMAN
PDB IDs Not Available
GenBank Gene ID AB009288
GeneCard ID CPNE6
GenAtlas ID CPNE6
HGNC ID HGNC:2319
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nakayama T, Yaoi T, Yasui M, Kuwajima G: N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression. FEBS Lett. 1998 May 22;428(1-2):80-4. [PubMed:9645480 ]