Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07626
Secondary Accession Numbers
  • 13335
Name Copine-8
Synonyms
  1. Copine VIII
Gene Name CPNE8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May function in membrane trafficking. Exhibits calcium- dependent phospholipid binding properties
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q12
SNPs CPNE8
Gene Sequence
>1695 bp
ATGGACAGCCGCTACAACAGCACTGCGGGCATCGGGGACTTGAACCAGCTGAGCGCTGCC
ATCCCGGCCACGCGGGTGGAGGTGTCCGTGTCCTGCAGAAATCTTCTTGACAGAGACACA
TTTTCTAAATCTGATCCAATTTGTGTCTTATATGTACAAGGAGTTGGAAATAAAGAATGG
AGAGAGTTTGGAAGAACTGAAGTAATTGATAATACTTTAAATCCTGATTTTGTAAGAAAG
TTTATTCTGGACTACTTTTTTGAAGAAAGAGAGAATCTTCGTTTTGACTTGTATGATGTT
GATTCAAAGAGCCCCAACTTATCCAAACATGACTTTCTGGGACAAGTGTTTTGTACATTG
GGAGAGATCGTTGGTTCACAGGGAAGTCGCCTGGAAAAACCAATAGTAGGAATTCCAGGG
AAGAAATGTGGTACAATCATACTTACAGCAGAGGAATTAAACTGTTGCAGGGATGCCGTT
TTGATGCAATTTTGTGCGAACAAATTGGACAAGAAGGACTTCTTTGGAAAATCAGATCCT
TTCCTTGTATTTTATCGAAGTAATGAAGATGGCAGTTTTACAATTTGTCACAAGACAGAA
GTTGTCAAAAACACTCTAAATCCAGTATGGCAAGCATTCAAGATCTCAGTCAGAGCATTA
TGTAATGGAGACTATGACAGAACAATCAAAGTAGAGGTGTATGACTGGGACCGAGATGGA
AGTCATGATTTCATTGGAGAATTTACAACAAGCTATAGGGAACTTTCTAGAGGGCAGTCA
CAATTCAACGTATATGAGGTGGTGAATCCCAAAAAGAAAGGAAAAAAGAAAAAATATACT
AATTCTGGAACAGTAACTTTACTCTCTTTCTTGGTAGAAACAGAAGTTTCATTCCTTGAC
TACATTAAGGGAGGGACGCAAATCAATTTCACAGTGGCTATTGATTTTACAGCATCAAAC
GGCAACCCTGCTCAGCCCACTTCCCTCCACTACATGAATCCTTACCAACTGAACGCCTAT
GGTATGGCACTAAAAGCAGTGGGAGAAATTGTTCAAGATTATGACAGTGATAAAATGTTT
CCAGCTCTAGGATTTGGTGCAAAACTGCCTCCAGATGGAAGGATATCTCACGAATTTGCT
TTGAATGGGAATCCTCAAAACCCCTACTGTGATGGCATTGAGGGGGTCATGGAGGCTTAT
TACAGGAGTCTGAAATCTGTACAACTATATGGGCCCACCAACTTTGCTCCTGTAATTAAT
CATGTAGCAAGATATGCTTCTTCTGTAAAGGATGGCTCCCAGTATTTTGTGCTTCTGATT
GTTACAGATGGTATTATCTCAGATATGGCCCAGACTAAGGAGTCCATAGTTAATGCCTCA
AAACTTCCAATGTCAATAATTATAGTAGGTGTTGGACCAGCAGAATTTGATGCAATGGTC
GAATTGGATGGAGATGATGTAAGAGTCTCCTCTAGAGGAAAATATGCTGAAAGAGACATT
GTGCAGTTTGTGCCATTCAGGGATTATATTGACAGAAGTGGAAACCACATACTGAGCATG
GCTAGATTGGCTAAAGATGTCCTAGCTGAGATCCCTGAGCAGTTTCTCTCCTATATGAGA
GCCCGAGGAATCAAGCCATCACCTGCGCCTCCCCCATACACCCCACCTACACATGTGTTA
CAGACTCAAATATGA
Protein Properties
Number of Residues 564
Molecular Weight 63107.1
Theoretical pI 5.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Copine-8
MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPICVLYVQGVGNKEW
REFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTL
GEIVGSQGSRLEKPIVGIPGKKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDP
FLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWDRDG
SHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLD
YIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMF
PALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVIN
HVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMV
ELDGDDVRVSSRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDVLAEIPEQFLSYMR
ARGIKPSPAPPPYTPPTHVLQTQI
GenBank ID Protein 27802463
UniProtKB/Swiss-Prot ID Q86YQ8
UniProtKB/Swiss-Prot Entry Name CPNE8_HUMAN
PDB IDs Not Available
GenBank Gene ID AY177785
GeneCard ID CPNE8
GenAtlas ID CPNE8
HGNC ID HGNC:23498
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]