You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07637
Secondary Accession Numbers
  • 13346
Name Cation channel sperm-associated protein 1
Synonyms
  1. CatSper1
  2. hCatSper
Gene Name CATSPER1
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-gated calcium channel that plays a central role in sperm cell hyperactivation. Controls calcium entry to mediate the hyperactivated motility, a step needed for sperm motility which is essential late in the preparation of sperm for fertilization. Activated by intracellular alkalinization
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Cell projection
  3. cilium
  4. flagellum membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12.1
SNPs CATSPER1
Gene Sequence
>2343 bp
ATGGATCAAAACTCAGTGCCTGAAAAGGCTCAGAATGAGGCAGACACCAATAACGCAGAT
AGGTTCTTTCGCTCTCACTCATCACCCCCACACCACAGGCCAGGCCACAGCAGAGCTCTC
CACCATTACGAGTTGCACCATCACGGCGTGCCCCACCAACGTGGTGAATCTCACCACCCT
CCGGAGTTCCAAGACTTCCACGACCAAGCCTTGTCCTCCCATGTCCACCAATCTCACCAC
CACAGCGAGGCACGGAATCACGGCAGAGCCCATGGCCCCACAGGCTTTGGTCTGGCTCCC
TCTCAAGGCGCCGTCCCCTCCCACCGTTCCTACGGTGAGGACTACCATGATGAGCTCCAA
CGTGATGGCAGGAGGCATCATGATGGGTCCCAATACGGTGGGTTCCATCAGCAGAGTGAC
TCCCATTACCATAGGGGGTCTCACCATGGCAGACCCCAATATCTCGGTGAGAATTTATCC
CACTATTCCTCTGGCGTGCCCCACCACGGTGAGGCTTCCCACCATGGTGGGTCCTACCTC
CCCCATGGACCCAATCCCTACAGTGAGTCCTTCCACCACAGCGAGGCTTCCCACCTTAGC
GGGCTCCAACACGATGAGTCCCAGCATCACCAAGTCCCCCACCGTGGCTGGCCCCACCAT
CACCAAGTCCACCACCATGGCAGGTCCCGTCATCATGAAGCCCACCAGCATGGAAAGTCT
CCTCATCACGGAGAGACCATTTCCCCTCATTCCTCTGTGGGGTCCTACCAGCGTGGGATA
TCTGACTATCACAGCGAGTACCACCAAGGTGATCACCACCCCAGTGAGTACCACCATGGC
GACCATCCCCACCACACACAGCACCACTACCACCAGACCCACCGGCACCGAGACTACCAT
CAGCACCAAGACCACCACGGCGCGTATCATTCCAGTTACCTCCATGGCGACTACGTCCAG
AGCACTTCCCAACTCTCTATCCCACACACATCCCGGAGCCTGATTCACGATGCCCCCGGC
CCTGCTGCTTCTCGTACAGGAGTCTTCCCCTATCACGTAGCACACCCACGGGGCTCGGCT
CACAGCATGACTCGGTCCTCCAGCACAATCCGCTCACGTGTCACCCAGATGTCCAAAAAA
GTCCATACCCAGGATATCTCCACCAAACATTCAGAAGACTGGGGCAAAGAAGAAGGGCAA
TTTCAGAAACGCAAAACCGGCAGGCTCCAGCGGACCCGCAAGAAGGGACACTCTACCAAT
CTCTTCCAGTGGCTGTGGGAAAAGCTAACCTTCCTCATTCAGGGCTTCCGGGAAATGATC
CGGAACCTGACCCAATCCTTGGCCTTTGAAACTTTCATCTTCTTCGTTGTCTGCCTCAAC
ACCGTCATGCTGGTGGCCCAGACCTTCGCTGAAGTCGAGATCCGGGGCGAGTGGTACTTC
ATGGCCTTGGACTCCATATTCTTCTGCATCTACGTGGTGGAAGCCCTGCTCAAGATCATC
GCCCTGGGCCTCTCGTACTTCTTTGACTTCTGGAACAATTTGGACTTCTTCATTATGGCC
ATGGCCGTGCTGGACTTCTTGCTGATGCAGACCCACTCCTTCGCCATCTACCACCAAAGC
CTCTTCCGGATCCTCAAGGTCTTCAAGAGCCTGCGGGCCCTGAGGGCAATCCGGGTCCTG
CGGAGGCTCAGCTTCCTGACCAGCGTCCAGGAAGTGACAGGGACCCTGGGCCAGTCCTTG
CCGTCCATCGCAGCCATCCTCATCCTCATGTTTACCTGCCTCTTCCTCTTCTCCGCGGTC
CTCCGGGCACTGTTCCGCAAATCTGACCCCAAGCGCTTCCAGAACATCTTCACCACCATC
TTCACCCTCTTCACCTTGCTCACGCTGGATGACTGGTCCCTCATCTACATGGACAGCCGT
GCCCAGGGCGCCTGGTACATCATTCCCATCCTCATAATTTACATCATCATCCAGTACTTC
ATCTTCCTCAACCTGGTGATTACTGTCCTGGTGGATAGCTTCCAGACGGCGCTGTTCAAA
GGCCTTGAGAAAGCGAAGCAGGAGAGGGCCGCCCGGATCCAAGAGAAGCTGCTGGAAGAC
TCACTGACGGAGCTCAGAGCTGCAGAGCCCAAAGAGGTGGCGAGTGAAGGCACCATGCTG
AAGCGGCTCATCGAGAAAAAGTTTGGGACCATGACTGAGAAGCAGCAGGAGCTCCTGTTC
CATTACCTGCAGCTGGTGGCAAGCGTGGAGCAGGAGCAGCAGAAGTTCCGCTCCCAGGCA
GCCGTCATCGATGAGATTGTGGACACCACATTTGAGGCTGGAGAAGAGGACTTCAGGAAT
TGA
Protein Properties
Number of Residues 780
Molecular Weight 90090.2
Theoretical pI 7.74
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 446-466
  • 486-506
  • 516-536
  • 542-562
  • 580-600
  • 647-667
Protein Sequence
>Cation channel sperm-associated protein 1
MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHP
PEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQ
RDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYL
PHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKS
PHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYH
QHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSA
HSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLVAQTFAEVEIRGEWYF
MALDSIFFCIYVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQS
LFRILKVFKSLRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAV
LRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRAQGAWYIIPILVIYIIIQYF
IFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLEDSLTELRAAEPKEVASEGTML
KRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTTFEAGEEDFRN
GenBank ID Protein 16076816
UniProtKB/Swiss-Prot ID Q8NEC5
UniProtKB/Swiss-Prot Entry Name CTSR1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF407333
GeneCard ID CATSPER1
GenAtlas ID CATSPER1
HGNC ID HGNC:17116
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Zhang D, Chen J, Saraf A, Cassar S, Han P, Rogers JC, Brioni JD, Sullivan JP, Gopalakrishnan M: Association of Catsper1 or -2 with Ca(v)3.3 leads to suppression of T-type calcium channel activity. J Biol Chem. 2006 Aug 4;281(31):22332-41. Epub 2006 Jun 1. [PubMed:16740636 ]
  4. Ren D, Navarro B, Perez G, Jackson AC, Hsu S, Shi Q, Tilly JL, Clapham DE: A sperm ion channel required for sperm motility and male fertility. Nature. 2001 Oct 11;413(6856):603-9. [PubMed:11595941 ]
  5. Nikpoor P, Mowla SJ, Movahedin M, Ziaee SA, Tiraihi T: CatSper gene expression in postnatal development of mouse testis and in subfertile men with deficient sperm motility. Hum Reprod. 2004 Jan;19(1):124-8. [PubMed:14688170 ]
  6. Li HG, Liao AH, Ding XF, Zhou H, Xiong CL: The expression and significance of CATSPER1 in human testis and ejaculated spermatozoa. Asian J Androl. 2006 May;8(3):301-6. [PubMed:16625279 ]
  7. Li HG, Ding XF, Liao AH, Kong XB, Xiong CL: Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility. Mol Hum Reprod. 2007 May;13(5):299-306. Epub 2007 Mar 8. [PubMed:17347248 ]
  8. Avenarius MR, Hildebrand MS, Zhang Y, Meyer NC, Smith LL, Kahrizi K, Najmabadi H, Smith RJ: Human male infertility caused by mutations in the CATSPER1 channel protein. Am J Hum Genet. 2009 Apr;84(4):505-10. doi: 10.1016/j.ajhg.2009.03.004. Epub 2009 Apr 2. [PubMed:19344877 ]