Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07639
Secondary Accession Numbers
  • 13348
Name Cation channel sperm-associated protein 3
Synonyms
  1. Ca(v)-like protein
  2. CatSper3
  3. One-repeat calcium channel-like protein
Gene Name CATSPER3
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-gated calcium channel that plays a central role in sperm cell hyperactivation. Controls calcium entry to mediate the hyperactivated motility, a step needed for sperm motility which is essential late in the preparation of sperm for fertilization. Activated by intracellular alkalinization
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Cell projection
  3. cilium
  4. flagellum membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs CATSPER3
Gene Sequence
>1197 bp
ATGTCTCAACACCGTCACCAGCGCCACTCGAGAGTCATTTCTAGTTCACCAGTTGACACT
ACATCGGTGGGATTTTGCCCAACATTCAAGAAATTTAAGAGGAACGATGATGAATGTCGG
GCATTTGTGAAGAGAGTCATAATGAGCCGTTTCTTTAAGATAATTATGATTAGCACTGTC
ACATCGAATGCGTTTTTTATGGCCTTGTGGACCAGTTATGACATAAGGTACCGCTTGTTC
AGACTTCTTGAGTTCTCGGAGATCTTCTTTGTGTCCATCTGCACATCTGAGTTGTCCATG
AAGGTCTATGTGGACCCCATCAACTACTGGAAGAACGGCTACAACCTGCTGGATGTGATC
ATTATCATCGTTATGTTTTTACCCTATGCCCTCCGCCAGCTCATGGGCAAACAGTTCACT
TACCTGTATATCGCTGATGGCATGCAGTCCCTGCGCATCCTCAAGCTTATCGGCTATAGC
CAGGGCATCCGGACGCTGATCACCGCCGTGGGGCAGACAGTCTACACCGTGGCCTCTGTG
CTCCTCCTGCTCTTCCTCCTCATGTACATCTTCGCTATCTTGGGCTTCTGCCTGTTTGGA
TCTCCAGACAATGGTGACCATGATAACTGGGGGAACCTGGCTGCGGCTTTTTTCACCCTC
TTCAGCTTGGCCACGGTTGATGGCTGGACAGACCTGCAGAAGCAGTTGGACAATCGGGAA
TTTGCTTTGAGCCGGGCATTCACCATCATCTTCATCTTGCTCGCCTCTTTCATCTTCCTC
AACATGTTCGTGGGTGTGATGATCATGCACACAGAGGACTCCATCAGAAAGTTTGAGCGA
GAGCTGATGTTGGAGCAGCAGGAGATGCTCATGGGAGAGAAGCAGGTGATTCTGCAGCGG
CAGCAGGAGGAGATCAGCAGGCTGATGCACATACAGAAAAATGCTGACTGCACAAGTTTC
AGTGAGCTGGTGGAGAACTTTAAGAAGACCTTGAGCCACACTGACCCAATGGTCTTGGAT
GATTTTGGCACTAGCTTACCCTTCATCGATATCTACTTTTCCACTCTGGACTACCAGGAC
ACAACTGTCCACAAGCTTCAAGAGCTGTACTATGAGATCGTGCATGTGCTGAGCCTAATG
CTGGAAGACTTGCCCCAGGAGAAGCCCCAGTCCTTGGAAAAGGTGGATGAGAAGTAG
Protein Properties
Number of Residues 398
Molecular Weight 46421.7
Theoretical pI 6.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 51-71
  • 79-100
  • 116-136
  • 142-161
  • 180-200
  • 249-269
Protein Sequence
>Cation channel sperm-associated protein 3
MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTV
TSNAFFMALWTSYDIRYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVI
IIIVMFLPYALRQLMGKQFTYLYIADGMQSLRILKLIGYSQGIRTLITAVGQTVYTVASV
LLLLFLLMYIFAILGFCLFGSPDNGDHDNWGNLAAAFFTLFSLATVDGWTDLQKQLDNRE
FALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR
QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQD
TTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK
GenBank ID Protein 29468142
UniProtKB/Swiss-Prot ID Q86XQ3
UniProtKB/Swiss-Prot Entry Name CTSR3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF432876
GeneCard ID CATSPER3
GenAtlas ID CATSPER3
HGNC ID HGNC:20819
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Li HG, Ding XF, Liao AH, Kong XB, Xiong CL: Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility. Mol Hum Reprod. 2007 May;13(5):299-306. Epub 2007 Mar 8. [PubMed:17347248 ]
  3. Arias JM, Murbartian J, Perez-Reyes E: Cloning of a novel one-repeat calcium channel-like gene. Biochem Biophys Res Commun. 2003 Mar 28;303(1):31-6. [PubMed:12646162 ]
  4. Lobley A, Pierron V, Reynolds L, Allen L, Michalovich D: Identification of human and mouse CatSper3 and CatSper4 genes: characterisation of a common interaction domain and evidence for expression in testis. Reprod Biol Endocrinol. 2003 Aug 1;1:53. [PubMed:12932298 ]