Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07640
Secondary Accession Numbers
  • 13349
Name Cation channel sperm-associated protein 4
Synonyms
  1. CatSper4
Gene Name CATSPER4
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Voltage-gated calcium channel that plays a central role in sperm cell hyperactivation. Controls calcium entry to mediate the hyperactivated motility, a step needed for sperm motility which is essential late in the preparation of sperm for fertilization. Activated by intracellular alkalinization
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Cell projection
  3. cilium
  4. flagellum membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 1p35.3
SNPs CATSPER4
Gene Sequence
>1419 bp
ATGAGGGATAATGAAAAGGCCTGGTGGCAGCAATGGACCTCCCATACAGGCCTCGAGGGG
TGGGGCGGGACTCAGGAGGACCGTATGGGGTTTGGAGGGGCAGTAGCTGCACTGAGGGGC
CGCCCCTCTCCCCTGCAGAGTACCATTCACGAGTCCTACGGTCGGCCAGAGGAGCAAGTG
CTCATCAACCGCCAGGAAATCACGAACAAAGCGGACGCCTGGGACATGCAGGAGTTCATC
ACTCACATGTACATCAAGCAGCTGCTCCGACACCCCGCCTTCCAACTGCTGCTGGCCCTG
CTGCTGGTGATCAATGCCATCACCATCGCTCTCCGTACCAACTCCTACCTGGACCAGAAA
CACTATGAGTTGTTCTCTACCATAGATGACATTGTGCTGACCATCCTTCTTTGTGAGGTT
CTCCTTGGCTGGCTCAATGGCTTCTGGATTTTCTGGAAGGACGGCTGGAACATCCTCAAC
TTCATTATCGTCTTTATCTTGCTCTTGCGGTTCTTCATTAATGAAATCAATATTCCCTCC
ATCAACTACACTCTCAGGGCGCTTCGTCTGGTGCATGTGTGCATGGCGGTGGAGCCCCTC
GCCCGGATCATCCGCGTCATCCTGCAGTCGGTGCCTGACATGGCCAATATCATGGTCCTC
ATCCTCTTCTTCATGCTGGTTTTTTCCGTGTTTGGAGTAACACTCTTTGGTGCATTCGTG
CCCAAGCATTTCCAGAACATACAGGTTGCGCTGTACACCCTCTTCATCTGCATCACCCAG
GACGGCTGGGTGGACATCTACAGTGACTTCCAGACAGAGAAGAGGGAATATGCAATGGAG
ATTGGGGGTGCCATCTACTTTACCATCTTCATCACCATCGGTGCCTTCATTGGCATCAAC
CTGTTCGTCATCGTGGTGACCACCAACCTGGAGCAAATGATGAAGGCAGGAGAGCAGGGA
CAACAGCAACGAATAACCTTTAGTGAGACAGGCGCAGAGGAAGAGGAGGAGAATGACCAG
CTGCCACTGGTGCATTGTGTGGTCGCCCGCTCGGAGAAATCTGGTCTCCTCCAGGAACCC
CTTGCGGGAGGCCCCCTGTCGAACCTCTCAGAAAACACGTGTGACAACTTTTGCTTGGTG
CTTGAGGCAATACAGGAGAACCTGAGGCAGTACAAGGAGATCCGAGATGAACTCAACATG
ATTGTGGAGGAGGTGCGCGCAATCCGCTTCAACCAGGAGCAGGAGTCAGAGGTGTTGAAC
AGGCGCTCGTCGACGAGCGGGTCGTTGGAGACTACGTCATCCAAGGACATCCGCCAGATG
TCTCAACAGCAAGACTTGCTCAGTGCGCTCGTTAGCATGGAAAAGGTTCATGACTCTAGC
TCACAAATACTCCTTAAAAAACACAAGAGCAGCCACTGA
Protein Properties
Number of Residues 472
Molecular Weight 54091.9
Theoretical pI 4.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 91-111
  • 131-151
  • 158-178
  • 180-197
  • 217-237
  • 285-305
Protein Sequence
>Cation channel sperm-associated protein 4
MRDNEKAWWQQWTSHTGLEGWGGTQEDRMGFGGAVAALRGRPSPLQSTIHESYGRPEEQV
LINRQEITNKADAWDMQEFITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQK
HYELFSTIDDIVLTILLCEVLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPS
INYTLRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLFGAFV
PKHFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGIN
LFVIVVTTNLEQMMKAGEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSGLLQEP
LAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQESEVLN
RRSSTSGSLETTSSKDIRQMSQQQDLLSALVSMEKVHDSSSQILLKKHKSSH
GenBank ID Protein 62988334
UniProtKB/Swiss-Prot ID Q7RTX7
UniProtKB/Swiss-Prot Entry Name CTSR4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_198137.1
GeneCard ID CATSPER4
GenAtlas ID CATSPER4
HGNC ID HGNC:23220
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Li HG, Ding XF, Liao AH, Kong XB, Xiong CL: Expression of CatSper family transcripts in the mouse testis during post-natal development and human ejaculated spermatozoa: relationship to sperm motility. Mol Hum Reprod. 2007 May;13(5):299-306. Epub 2007 Mar 8. [PubMed:17347248 ]
  4. Lobley A, Pierron V, Reynolds L, Allen L, Michalovich D: Identification of human and mouse CatSper3 and CatSper4 genes: characterisation of a common interaction domain and evidence for expression in testis. Reprod Biol Endocrinol. 2003 Aug 1;1:53. [PubMed:12932298 ]