You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07649
Secondary Accession Numbers
  • 13358
Name Dentin matrix acidic phosphoprotein 1
Synonyms
  1. DMP-1
  2. Dentin matrix protein 1
Gene Name DMP1
Protein Type Unknown
Biological Properties
General Function Involved in ossification
Specific Function May have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, unphosphorylated form acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase it is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite
Pathways Not Available
Reactions Not Available
GO Classification
Process
multicellular organismal process
extracellular matrix organization
ossification
cellular process
cellular component organization at cellular level
extracellular structure organization
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Secreted
  4. extracellular space
  5. extracellular matrix
Gene Properties
Chromosome Location Chromosome:4
Locus 4q21
SNPs DMP1
Gene Sequence
>1542 bp
ATGAAGATCAGCATCCTGCTCATGTTCCTTTGGGGATTATCCTGTGCTCTCCCAGTAACC
AGGTATCAAAATAATGAATCTGAGGATTCTGAAGAATGGAAGGGTCATTTGGCTCAGGCA
CCAACACCACCCTTGGAGAGCAGTGAGTCATCAGAAGGCAGTAAAGTTAGCTCAGAGGAA
CAGGCAAATGAAGACCCCAGTGACAGCACTCAGTCAGAGGAGGGCCTGGGCTCTGATGAT
CATCAATACATTTATAGGCTAGCTGGTGGCTTCTCCAGGAGCACAGGAAAAGGAGGAGAT
GATAAAGATGACGATGAAGATGACAGTGGAGATGACACCTTTGGTGACGATGACAGTGGC
CCAGGGCCCAAAGACAGACAAGAAGGAGGAAACTCCAGACTGGGAAGTGATGAGGACTCT
GATGACACCATACAAGCCAGTGAAGAGAGTGCCCCACAAGGGCAAGACAGTGCCCAAGAT
ACCACCAGTGAGAGCAGGGAACTTGACAATGAGGACCGGGTGGACAGCAAGCCTGAGGGA
GGTGACTCCACTCAAGAGAGTGAGAGTGAAGAGCACTGGGTGGGAGGTGGCAGTGATGGG
GAGAGCAGCCATGGAGACGGCTCCGAGTTGGACGATGAGGGAATGCAGAGTGATGACCCA
GAGAGCATCAGGAGTGAAAGGGGAAACTCCAGAATGAACAGTGCAGGCATGAAATCAAAA
GAATCTGGAGAAAACAGTGAGCAAGCAAACACTCAAGATTCAGGTGGCAGCCAATTGCTG
GAGCATCCCAGTAGGAAAATTTTTAGGAAGTCTCGCATCTCAGAGGAAGATGACAGAAGC
GAGCTTGATGACAACAACACAATGGAAGAAGTCAAGAGTGACTCTACAGAAAACAGCAAC
TCCAGAGACACTGGCCTCAGCCAACCCAGGAGAGACAGCAAGGGTGACTCTCAAGAAGAC
AGCAAGGAGAATCTGTCCCAGGAAGAGAGCCAAAACGTAGATGGTCCCAGCAGTGAGTCC
AGCCAAGAGGCCAACCTGTCATCTCAAGAGAACAGCAGTGAGTCTCAGGAAGAGGTGGTG
AGTGAGTCCAGGGGAGATAACCCCGACCCCACAACTAGTTATGTAGAAGACCAGGAAGAC
AGTGACTCCAGCGAGGAGGACAGCTCGCACACACTCTCCCACTCAAAAAGTGAATCCAGA
GAGGAGCAAGCAGACAGTGAATCCAGTGAAAGCCTCAACTTCTCAGAGGAAAGCCCGGAG
TCCCCTGAGGATGAGAACAGCTCCAGCCAGGAGGGCCTCCAGTCTCACAGCAGCTCAGCA
GAGAGTCAGAGCGAGGAAAGCCATTCTGAGGAAGACGACAGTGACTCTCAAGACAGCAGC
AGATCCAAAGAAGATAGCAACTCCACGGAGAGCAAATCAAGCAGTGAGGAAGATGGCCAG
TTGAAAAACATTGAGATAGAGAGCCGGAAATTAACAGTTGATGCCTATCACAACAAACCC
ATTGGGGACCAAGATGACAATGACTGCCAAGACGGCTATTAG
Protein Properties
Number of Residues 513
Molecular Weight 55781.9
Theoretical pI 3.76
Pfam Domain Function
Signals
  • 1-16
Transmembrane Regions
  • None
Protein Sequence
>Dentin matrix acidic phosphoprotein 1
MKISILLMFLWGLSCALPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEE
QANEDPSDSTQSEEGLGSDDHQYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSG
PGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSESRELDNEDRVDSKPEG
GDSTQESESEEHWVGGGSDGESSHGDGSELDDEGMQSDDPESIRSERGNSRMNSAGMKSK
ESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSN
SRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVV
SESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADSESSESLNFSEESPE
SPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTESKSSSEEDGQ
LKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGY
GenBank ID Protein 120660278
UniProtKB/Swiss-Prot ID Q13316
UniProtKB/Swiss-Prot Entry Name DMP1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC130581
GeneCard ID DMP1
GenAtlas ID DMP1
HGNC ID HGNC:2932
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hirst KL, Simmons D, Feng J, Aplin H, Dixon MJ, MacDougall M: Elucidation of the sequence and the genomic organization of the human dentin matrix acidic phosphoprotein 1 (DMP1) gene: exclusion of the locus from a causative role in the pathogenesis of dentinogenesis imperfecta type II. Genomics. 1997 May 15;42(1):38-45. [PubMed:9177774 ]
  3. Aplin HM, Hirst KL, Crosby AH, Dixon MJ: Mapping of the human dentin matrix acidic phosphoprotein gene (DMP1) to the dentinogenesis imperfecta type II critical region at chromosome 4q21. Genomics. 1995 Nov 20;30(2):347-9. [PubMed:8586437 ]
  4. Narayanan K, Ramachandran A, Hao J, He G, Park KW, Cho M, George A: Dual functional roles of dentin matrix protein 1. Implications in biomineralization and gene transcription by activation of intracellular Ca2+ store. J Biol Chem. 2003 May 9;278(19):17500-8. Epub 2003 Mar 3. [PubMed:12615915 ]
  5. Lorenz-Depiereux B, Bastepe M, Benet-Pages A, Amyere M, Wagenstaller J, Muller-Barth U, Badenhoop K, Kaiser SM, Rittmaster RS, Shlossberg AH, Olivares JL, Loris C, Ramos FJ, Glorieux F, Vikkula M, Juppner H, Strom TM: DMP1 mutations in autosomal recessive hypophosphatemia implicate a bone matrix protein in the regulation of phosphate homeostasis. Nat Genet. 2006 Nov;38(11):1248-50. Epub 2006 Oct 8. [PubMed:17033625 ]
  6. Feng JQ, Ward LM, Liu S, Lu Y, Xie Y, Yuan B, Yu X, Rauch F, Davis SI, Zhang S, Rios H, Drezner MK, Quarles LD, Bonewald LF, White KE: Loss of DMP1 causes rickets and osteomalacia and identifies a role for osteocytes in mineral metabolism. Nat Genet. 2006 Nov;38(11):1310-5. Epub 2006 Oct 8. [PubMed:17033621 ]