You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07655
Secondary Accession Numbers
  • 13364
Name Desmocollin-1
Synonyms
  1. Cadherin family member 1
  2. DG2/DG3
  3. Desmosomal glycoprotein 2/3
Gene Name DSC1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms. Linked to the keratinization of epithelial tissues
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
  4. desmosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12.2|18q12.1
SNPs DSC1
Gene Sequence
>2685 bp
ATGGCTCTGGCCTCTGCTGCCCCAGGGAGCATCTTCTGTAAGCAGCTCCTTTTCTCTCTC
CTGGTTTTAACATTACTTTGCGATGCTTGTCAGAAAGTTTATCTTCGAGTTCCTTCTCAT
CTTCAGGCTGAAACACTTGTAGGCAAAGTGAATCTGGAGGAGTGTCTCAAGTCGGCCAGC
CTAATCCGGTCCAGTGACCCTGCCTTCAGAATTCTAGAAGATGGCTCAATTTACACAACA
CATGACCTCATTTTGTCTTCTGAAAGGAAAAGTTTTTCCATTTTCCTTTCAGATGGTCAG
AGACGGGAACAACAAGAGATAAAAGTTGTACTGTCAGCAAGAGAAAACAAGTCTCCTAAG
AAGAGACATACCAAAGACACAGCCCTCAAGCGCAGCAAGAGACGATGGGCTCCTATTCCA
GCTTCATTGATGGAGAACTCGTTGGGTCCATTTCCACAACACGTTCAGCAGATCCAATCT
GATGCTGCACAGAATTACACCATCTTTTATTCCATAAGTGGGCCAGGCGTGGACAAAGAA
CCCTTCAATTTGTTTTACATAGAGAAAGACACTGGGGATATCTTTTGTACAAGGAGCATT
GACCGTGAGAAATACGAACAGTTTGCGTTATATGGCTATGCAACAACTGCAGATGGCTAT
GCACCAGAATATCCACTCCCTTTGATCATCAAAATTGAAGATGATAATGATAACGCCCCA
TATTTTGAACACAGAGTGACTATCTTTACTGTGCCTGAAAATTGCCGATCCGGAACTTCA
GTGGGAAAAGTGACCGCCACAGACCTTGACGAACCTGACACTCTCCATACTCGTCTGAAA
TATAAAATCTTACAACAAATCCCAGATCATCCAAAGCATTTCTCCATACACCCAGATACC
GGTGTCATCACCACAACTACACCTTTTCTGGATAGAGAAAAATGTGATACTTACCAGTTA
ATAATGGAAGTGCGAGACATGGGTGGTCAGCCTTTCGGTTTATTTAATACAGGAACAATT
ACTATTTCACTTGAGGATGAAAATGACAATCCACCATCTTTCACAGAAACTTCTTATGTT
ACAGAAGTAGAAGAAAACAGAATTGACGTGGAGATTTTGCGAATGAAGGTACAGGATCAG
GATTTGCCAAACACTCCTCACTCAAAGGCTGTATACAAAATCTTACAAGGAAATGAAAAT
GGAAACTTCATAATTAGCACAGATCCAAATACAAATGAAGGAGTGCTGTGTGTTGTCAAG
CCATTGAACTATGAAGTCAATCGCCAAGTTATTTTGCAAGTTGGTGTCATTAACGAGGCA
CAATTCTCTAAAGCAGCGAGCTCACAAACTCCTACAATGTGCACTACAACTGTCACCGTT
AAAATTATAGACAGTGATGAGGGCCCTGAATGCCACCCTCCAGTGAAAGTTATTCAGAGT
CAAGATGGCTTCCCAGCTGGCCAAGAACTCCTTGGATACAAAGCACTGGACCCGGAAATA
TCCAGTGGTGAAGGCTTAAGGTATCAGAAGTTAGGGGATGAAGATAACTGGTTTGAAATT
AATCAACACACTGGCGACTTGAGAACTCTAAAAGTACTAGATAGAGAATCCAAATTTGTA
AAAAACAACCAATACAATATTTCAGTTGTTGCAGTGGATGCAGTTGGCCGATCTTGCACT
GGAACATTAGTAGTTCATTTGGATGATTACAACGATCACGCACCTCAAATTGACAAAGAA
GTGACCATTTGTCAGAATAATGAGGATTTTGCTGTTCTGAAACCTGTAGATCCAGATGGA
CCTGAAAATGGACCACCTTTTCAATTCTTTCTGGATAATTCTGCCAGTAAAAACTGGAAC
ATAGAAGAAAAGGATGGTAAAACTGCCATTCTTCGTCAACGGCAAAATCTTGATTATAAC
TATTATTCTGTGCCTATTCAAATAAAAGACAGGCATGGTTTAGTTGCAACACATATGTTA
ACAGTGAGAGTATGTGACTGTTCAACTCCATCTGAGTGTAGAATGAAGGATAAAAGTACA
AGAGACGTTAGACCAAATGTAATACTTGGAAGATGGGCTATTCTTGCTATGGTGTTGGGT
TCTGTATTGTTATTATGTATTCTGTTTACATGTTTCTGTGTCACTGCTAAGAGAACAGTC
AAGAAATGTTTTCCAGAAGACATAGCCCAGCAAAATTTAATTGTATCAAATACTGAAGGA
CCTGGAGAAGAAGTAACGGAAGCAAATATTAGACTCCCCATGCAGACATCCAACATTTGT
GACACAAGCATGTCTGTTGGTACTGTTGGTGGCCAGGGAATCAAAACACAGCAAAGTTTT
GAGATGGTCAAAGGAGGCTACACTTTGGATTCCAACAAAGGAGGTGGACATCAGACCTTG
GAGTCCGTCAAGGGAGTGGGGCAGGGAGATACTGGCAGATATGCGTACACGGACTGGCAG
AGTTTCACCCAACCTCGGCTTGGCGAAAAGGTGTATTTGTGTGGACAAGATGAGGAGCAT
AAACATTGTGAAGACTACGTTTGTTCGTATAACTATGAAGGCAAAGGTTCTCTGGCCGGC
TCAGTAGGTTGCTGCAGCGATCGGCAGGAAGAAGAGGGACTGGAGTTTCTAGATCACCTG
GAACCCAAATTTAGGACATTAGCAAAGACATGCATCAAGAAATAA
Protein Properties
Number of Residues 894
Molecular Weight 99986.1
Theoretical pI 5.08
Pfam Domain Function
Signals
  • 1-29
Transmembrane Regions
  • 692-714
Protein Sequence
>Desmocollin-1
MALASAAPGSIFCKQLLFSLLVLTLLCDACQKVYLRVPSHLQAETLVGKVNLEECLKSAS
LIRSSDPAFRILEDGSIYTTHDLILSSERKSFSIFLSDGQRREQQEIKVVLSARENKSPK
KRHTKDTALKRSKRRWAPIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKE
PFNLFYIEKDTGDIFCTRSIDREKYEQFALYGYATTADGYAPEYPLPLIIKIEDDNDNAP
YFEHRVTIFTVPENCRSGTSVGKVTATDLDEPDTLHTRLKYKILQQIPDHPKHFSIHPDT
GVITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTETSYV
TEVEENRIDVEILRMKVQDQDLPNTPHSKAVYKILQGNENGNFIISTDPNTNEGVLCVVK
PLNYEVNRQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQS
QDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTGDLRTLKVLDRESKFV
KNNQYNISVVAVDAVGRSCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDG
PENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHML
TVRVCDCSTPSECRMKDKSTRDVRPNVILGRWAILAMVLGSVLLLCILFTCFCVTAKRTV
KKCFPEDIAQQNLIVSNTEGPGEEVTEANIRLPMQTSNICDTSMSVGTVGGQGIKTQQSF
EMVKGGYTLDSNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEH
KHCEDYVCSYNYEGKGSLAGSVGCCSDRQEEEGLEFLDHLEPKFRTLAKTCIKK
GenBank ID Protein 10801202
UniProtKB/Swiss-Prot ID Q08554
UniProtKB/Swiss-Prot Entry Name DSC1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF293358
GeneCard ID DSC1
GenAtlas ID DSC1
HGNC ID HGNC:3035
References
General References
  1. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  2. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921 ]
  3. Theis DG, Koch PJ, Franke WW: Differential synthesis of type 1 and type 2 desmocollin mRNAs in human stratified epithelia. Int J Dev Biol. 1993 Mar;37(1):101-10. [PubMed:8507556 ]
  4. King IA, Arnemann J, Spurr NK, Buxton RS: Cloning of the cDNA (DSC1) coding for human type 1 desmocollin and its assignment to chromosome 18. Genomics. 1993 Nov;18(2):185-94. [PubMed:8288219 ]
  5. Whittock NV, Hunt DM, Rickman L, Malhi S, Vogazianou AP, Dawson LF, Eady RA, Buxton RS, McGrath JA: Genomic organization and amplification of the human desmosomal cadherin genes DSC1 and DSC3, encoding desmocollin types 1 and 3. Biochem Biophys Res Commun. 2000 Sep 24;276(2):454-60. [PubMed:11027496 ]
  6. King IA, Magee AI, Rees DA, Buxton RS: Keratinization is associated with the expression of a new protein related to the desmosomal cadherins DGII/III. FEBS Lett. 1991 Jul 29;286(1-2):9-12. [PubMed:1713860 ]