You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07658
Secondary Accession Numbers
  • 13367
Name Desmoglein-1
Synonyms
  1. Cadherin family member 4
  2. DG1
  3. DGI
  4. Desmosomal glycoprotein 1
  5. Pemphigus foliaceus antigen
Gene Name DSG1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
  4. desmosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12.1
SNPs DSG1
Gene Sequence
>3150 bp
ATGGACTGGAGTTTCTTCAGAGTAGTTGCAATGCTGTTCATTTTTCTGGTGGTGGTAGAA
GTTAACAGTGAATTCCGAATCCAGGTAAGAGATTATAACACTAAAAATGGCACCATCAAA
TGGCATTCAATCCGAAGGCAGAAACGTGAATGGATCAAGTTCGCAGCAGCCTGTCGTGAA
GGTGAAGACAACTCAAAGAGGAACCCAATCGCCAAAATTCACTCAGATTGTGCTGCAAAC
CAGCAAGTTACATACCGCATCTCTGGAGTAGGAATTGATCAGCCACCATATGGGATCTTT
GTCATTAATCAGAAAACTGGTGAAATTAATATAACATCCATAGTTGATCGAGAGGTCACT
CCTTTCTTCATTATCTACTGCCGAGCTCTGAACTCAATGGGCCAAGATTTAGAGAGGCCT
CTAGAGCTCAGAGTCAGGGTTTTGGATATAAATGACAACCCTCCAGTGTTTTCAATGGCT
ACATTTGCAGGACAAATAGAAGAAAATTCTAATGCAAATACACTGGTGATGATACTCAAT
GCTACTGACGCAGATGAACCGAACAATTTGAACTCAAAAATAGCCTTCAAGATTATAAGA
CAAGAACCTTCAGATTCACCAATGTTTATTATCAACAGAAATACTGGAGAAATTCGAACG
ATGAATAATTTTCTAGACAGAGAGCAATACGGCCAGTATGCTCTTGCTGTAAGAGGCTCT
GACCGAGATGGTGGGGCAGATGGCATGTCAGCGGAATGTGAGTGCAACATTAAAATCCTC
GATGTCAATGATAATATCCCTTACATGGAACAGTCTTCATATACCATAGAAATTCAAGAA
AATACTCTAAATTCAAATTTGCTCGAGATTAGAGTAATTGATTTGGATGAAGAGTTCTCA
GCTAACTGGATGGCAGTAATTTTCTTTATCTCTGGAAATGAAGGAAATTGGTTTGAGATA
GAAATGAATGAAAGAACAAATGTGGGAATTTTAAAGGTTGTTAAGCCCTTAGATTATGAA
GCTATGCAGAGTCTGCAACTCAGTATTGGTGTCAGAAATAAAGCTGAATTTCATCATTCA
ATTATGTCTCAATATAAACTGAAAGCATCTGCAATTTCTGTGACTGTGTTAAATGTAATT
GAAGGCCCAGTGTTTCGTCCAGGTTCAAAGACATATGTTGTAACTGGTAATATGGGATCA
AATGATAAAGTGGGAGACTTTGTAGCTACTGACCTGGACACAGGTAGACCTTCAACGACT
GTTAGGTATGTAATGGGAAATAATCCAGCTGACCTGCTAGCTGTTGATTCAAGAACAGGC
AAACTCACTTTGAAAAATAAAGTTACCAAGGAACAGTACAATATGCTCGGAGGAAAATAC
CAAGGAACGATTCTCTCTATAGATGATAATCTTCAAAGAACTTGCACTGGTACAATTAAT
ATTAACATTCAAAGTTTTGGTAATGACGACAGGACTAATACAGAGCCGAACACTAAAATT
ACTACCAATACTGGCAGACAAGAAAGTACTTCTTCCACTAACTATGATACCAGCACAACT
TCTACTGACTCTAGCCAAGTATATTCTTCTGAACCCGGAAACGGAGCCAAAGATTTGTTA
TCAGACAATGTACATTTTGGTCCTGCTGGCATTGGACTCCTCATCATGGGATTCTTGGTC
TTAGGATTGGTCCCATTTTTGATGATCTGTTGTGATTGTGGAGGTGCTCCTCGTAGTGCA
GCTGGCTTTGAGCCTGTTCCCGAATGTTCAGATGGAGCAATTCATTCATGGGCAGTAGAA
GGACCACAGCCTGAACCCAGGGATATAACCACTGTCATACCACAAATACCACCTGATAAC
GCAAATATAATTGAATGCATTGACAACTCAGGAGTTTATACAAATGAGTATGGTGGCAGA
GAAATGCAAGATCTGGGAGGAGGAGAGAGAATGACAGGATTTGAACTAACAGAGGGAGTT
AAAACTTCAGGAATGCCTGAGATATGTCAAGAATACTCTGGAACATTAAGAAGAAATTCT
ATGAGGGAATGTAGAGAAGGAGGTCTGAATATGAATTTCATGGAAAGCTACTTCTGTCAG
AAAGCATATGCTTACGCAGATGAAGATGAAGGACGCCCATCTAATGACTGTTTGCTCATA
TATGACATCGAAGGTGTAGGTTCCCCTGCTGGCTCTGTGGGTTGTTGTAGCTTCATTGGA
GAAGACCTGGATGACAGCTTCTTGGATACCCTGGGACCTAAATTTAAGAAGTTGGCAGAC
ATCAGCCTAGGAAAAGAATCATATCCAGACCTTGATCCTTCTTGGCCACCACAAAGCACT
GAACCAGTTTGCCTTCCTCAGGAAACAGAGCCCGTTGTTAGTGGACACCCACCAATCTCC
CCACATTTCGGCACTACCACAGTAATTTCTGAGAGCACCTATCCCTCGGGACCTGGTGTA
CTGCATCCTAAGCCTATTCTCGATCCTCTGGGCTATGGTAATGTCACTGTGACCGAGTCT
TACACCACCTCTGACACTCTGAAGCCCTCTGTGCACGTTCACGATAACCGACCAGCATCA
AACGTGGTAGTGACAGAGAGAGTGGTCGGCCCAATCTCTGGCGCTGATTTGCATGGAATG
TTAGAGATGCCTGACTTGCGAGATGGGTCGAATGTTATAGTGACAGAAAGGGTAATAGCA
CCAAGCTCTAGTCTACCCACCTCTCTGACTATCCATCATCCTAGAGAGTCTTCAAATGTG
GTAGTGACAGAAAGAGTAATCCAACCAACTTCCGGCATGATAGGTAGTCTGAGTATGCAC
CCCGAGTTAGCCAATGCCCACAATGTCATTGTGACAGAGAGGGTTGTTTCTGGTGCTGGC
GTAACTGGAATTAGTGGCACCACTGGGATCAGCGGTGGCATAGGCAGCAGTGGCCTGGTT
GGCACCAGCATGGGTGCTGGGAGCGGTGCCCTGAGTGGAGCTGGCATAAGTGGTGGTGGC
ATTGGCCTGAGCAGCTTGGGAGGGACAGCCAGCATTGGCCACATGAGGAGTTCCTCTGAC
CATCACTTTAACCAAACCATTGGGTCCGCCTCCCCTAGCACAGCTCGAAGTCGAATCACA
AAGTATAGTACCGTGCAATATAGCAAGTAG
Protein Properties
Number of Residues 1049
Molecular Weight 113746.7
Theoretical pI 4.66
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • 549-569
Protein Sequence
>Desmoglein-1
MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT
PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFS
ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHS
IMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTIN
INIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL
SDNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVE
GPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGV
KTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLI
YDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQST
EPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIA
PSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAG
VTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSD
HHFNQTIGSASPSTARSRITKYSTVQYSK
GenBank ID Protein 119703744
UniProtKB/Swiss-Prot ID Q02413
UniProtKB/Swiss-Prot Entry Name DSG1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001942.2
GeneCard ID DSG1
GenAtlas ID DSG1
HGNC ID HGNC:3048
References
General References
  1. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  2. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503. [PubMed:16740002 ]
  3. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  4. Wheeler GN, Parker AE, Thomas CL, Ataliotis P, Poynter D, Arnemann J, Rutman AJ, Pidsley SC, Watt FM, Rees DA, et al.: Desmosomal glycoprotein DGI, a component of intercellular desmosome junctions, is related to the cadherin family of cell adhesion molecules. Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):4796-800. [PubMed:1711210 ]
  5. Nilles LA, Parry DA, Powers EE, Angst BD, Wagner RM, Green KJ: Structural analysis and expression of human desmoglein: a cadherin-like component of the desmosome. J Cell Sci. 1991 Aug;99 ( Pt 4):809-21. [PubMed:1770008 ]
  6. Rickman L, Simrak D, Stevens HP, Hunt DM, King IA, Bryant SP, Eady RA, Leigh IM, Arnemann J, Magee AI, Kelsell DP, Buxton RS: N-terminal deletion in a desmosomal cadherin causes the autosomal dominant skin disease striate palmoplantar keratoderma. Hum Mol Genet. 1999 Jun;8(6):971-6. [PubMed:10332028 ]