You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07659
Secondary Accession Numbers
  • 13368
Name Desmoglein-2
Synonyms
  1. Cadherin family member 5
  2. HDGC
Gene Name DSG2
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
plasma membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
  4. desmosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q12.1
SNPs DSG2
Gene Sequence
>3357 bp
ATGGCGCGGAGCCCGGGACGCGCGTACGCCCTGCTGCTTCTCCTGATCTGCTTTAACGTT
GGAAGTGGACTTCACTTACAGGTCTTAAGCACAAGAAATGAAAATAAGCTGCTTCCTAAA
CATCCTCATTTAGTGCGGCAAAAGCGCGCCTGGATCACCGCCCCCGTGGCTCTTCGGGAG
GGAGAGGATCTGTCCAAGAAGAATCCAATTGCCAAGATACATTCTGATCTTGCAGAAGAA
AGAGGACTCAAAATTACTTACAAATACACTGGAAAAGGGATTACAGAGCCACCTTTTGGT
ATATTTGTCTTTAACAAAGATACTGGAGAACTGAATGTTACCAGCATTCTTGATCGAGAA
GAAACACCATTTTTTCTGCTAACAGGTTACGCTTTGGATGCAAGAGGAAACAATGTAGAG
AAACCCTTAGAGCTACGCATTAAGGTTCTTGATATCAATGACAACGAACCAGTGTTCACA
CAGGATGTCTTTGTTGGGTCTGTTGAAGAGTTGAGTGCAGCACATACTCTTGTGATGAAA
ATCAATGCAACAGATGCAGATGAGCCCAATACCCTGAATTCGAAAATTTCCTATAGAATC
GTATCTCTGGAGCCTGCTTATCCTCCAGTGTTCTACCTAAATAAAGATACAGGAGAGATT
TATACAACCAGTGTTACCTTGGACAGAGAGGAACACAGCAGCTACACTTTGACAGTAGAA
GCAAGAGATGGCAATGGAGAAGTTACAGACAAACCTGTAAAACAAGCTCAAGTTCAGATT
CGTATTTTGGATGTCAATGACAATATACCTGTAGTAGAAAATAAAGTGCTTGAAGGGATG
GTTGAAGAAAATCAAGTCAATGTAGAAGTTACGCGCATAAAAGTGTTCGATGCAGATGAA
ATAGGTTCTGATAATTGGCTGGCAAATTTTACATTTGCATCAGGAAATGAAGGAGGTTAT
TTCCACATAGAAACAGATGCTCAAACTAACGAAGGAATTGTGACCCTTATTAAGGAAGTA
GATTATGAAGAAATGAAGAATCTTGACTTCAGTGTTATTGTCGCTAATAAAGCAGCTTTT
CACAAGTCGATTAGGAGTAAATACAAGCCTACACCCATTCCCATCAAGGTCAAAGTGAAA
AATGTGAAAGAAGGCATTCATTTTAAAAGCAGCGTCATCTCAATTTATGTTAGCGAGAGC
ATGGATAGATCAAGCAAAGGCCAAATAATTGGAAATTTTCAAGCTTTTGATGAGGACACT
GGACTACCAGCCCATGCAAGATATGTAAAATTAGAAGATAGAGATAATTGGATCTCTGTG
GATTCTGTCACATCTGAAATTAAACTTGCAAAACTTCCTGATTTTGAATCTAGATATGTT
CAAAATGGCACATACACTGTAAAGATTGTGGCCATATCAGAAGATTATCCTAGAAAAACC
ATCACTGGCACAGTCCTTATCAATGTTGAAGACATCAACGACAACTGTCCCACACTGATA
GAGCCTGTGCAGACAATCTGTCACGATGCAGAGTATGTGAATGTTACTGCAGAGGACCTG
GATGGACACCCAAACAGTGGCCCTTTCAGTTTCTCCGTCATTGACAAACCACCTGGCATG
GCAGAAAAATGGAAAATAGCACGCCAAGAAAGTACCAGTGTGCTGCTGCAACAAAGTGAG
AAAAAGCTTGGGAGAAGTGAAATTCAGTTCCTGATTTCAGACAATCAGGGTTTTAGTTGT
CCTGAAAAGCAGGTCCTTACACTCACAGTTTGTGAGTGTCTGCATGGCAGCGGCTGCAGG
GAAGCACAGCATGACTCCTATGTGGGCCTGGGACCCGCAGCAATTGCGCTCATGATTTTG
GCCTTTCTGCTCCTGCTATTGGTACCACTTTTACTGCTGATGTGCCATTGCGGAAAGGGC
GCCAAAGGCTTTACCCCCATACCTGGCACCATAGAGATGCTGCATCCTTGGAATAATGAA
GGAGCACCACCTGAAGACAAGGTGGTGCCATCATTTCTGCCAGTGGATCAAGGGGGCAGT
CTAGTAGGAAGAAATGGAGTAGGAGGTATGGCCAAGGAAGCCACGATGAAAGGAAGTAGC
TCTGCTTCCATTGTCAAAGGGCAACATGAGATGTCCGAGATGGATGGAAGGTGGGAAGAA
CACAGAAGCCTGCTTTCTGGTAGAGCTACCCAGTTTACAGGGGCCACAGGCGCTATCATG
ACCACTGAAACCACGAAGACCGCAAGGGCCACAGGGGCTTCCAGAGACATGGCCGGAGCT
CAGGCAGCTGCTGTTGCACTGAACGAAGAATTCTTAAGAAATTATTTCACTGATAAAGCG
GCCTCTTACACTGAGGAAGATGAAAATCACACAGCCAAAGATTGCCTTCTGGTTTATTCT
CAGGAAGAAACTGAATCGCTGAATGCTTCTATTGGTTGTTGCAGTTTTATTGAAGGAGAG
CTAGATGACCGCTTCTTAGATGATTTGGGACTTAAATTCAAGACGCTAGCTGAAGTTTGC
CTGGGTCAAAAAATAGATATAAATAAGGAAATTGAGCAGAGACAAAAACCTGCCACAGAA
ACAAGTATGAACACAGCTTCACATTCACTCTGTGAGCAAACTATGGTTAATTCAGAGAAT
ACCTACTCCTCTGGCAGTAGCTTCCCAGTTCCAAAATCTTTGCAAGAAGCCAATGCAGAG
AAAGTAACTCAGGAAATAGTCACTGAAAGATCTGTGTCTTCTAGGCAGGCGCAAAAGGTA
GCTACACCTCTTCCTGACCCAATGGCTTCTAGAAATGTGATAGCAACAGAAACTTCCTAT
GTCACAGGGTCCACTATGCCACCAACCACTGTGATCCTGGGTCCTAGCCAGCCACAGAGC
CTTATTGTGACAGAGAGGGTGTATGCTCCAGCTTCTACCTTGGTAGATCAGCCTTATGCT
AATGAAGGTACAGTTGTGGTCACTGAAAGAGTAATACAGCCTCATGGGGGTGGATCGAAT
CCTCTGGAAGGCACTCAGCATCTTCAAGATGTACCTTACGTCATGGTGAGGGAAAGAGAG
AGCTTCCTTGCCCCCAGCTCAGGTGTGCAGCCTACTCTGGCCATGCCTAATATAGCAGTA
GGACAGAATGTGACAGTGACAGAAAGAGTTCTAGCACCTGCTTCCACTCTGCAATCCAGT
TACCAGATTCCCACTGAAAATTCTATGACGGCTAGGAACACCACGGTGTCTGGAGCTGGA
GTCCCTGGCCCTCTGCCAGATTTTGGTTTAGAGGAATCTGGTCATTCTAATTCTACCATA
ACCACATCTTCCACCAGAGTCACCAAGCATAGCACTGTACAGCATTCTTACTCCTAA
Protein Properties
Number of Residues 1118
Molecular Weight 122293.0
Theoretical pI 4.89
Pfam Domain Function
Signals
  • 1-23
Transmembrane Regions
  • 610-634
Protein Sequence
>Desmoglein-2
MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALRE
GEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDRE
ETPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMK
INATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVE
ARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADE
IGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVANKAAF
HKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDT
GLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKT
ITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGM
AEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCR
EAQHDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGAKGFTPIPGTIEMLHPWNNE
GAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEE
HRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKA
ASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVC
LGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAE
KVTQEIVTERSVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQS
LIVTERVYAPASTLVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERE
SFLAPSSGVQPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMTARNTTVSGAG
VPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
GenBank ID Protein 68563344
UniProtKB/Swiss-Prot ID Q14126
UniProtKB/Swiss-Prot Entry Name DSG2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC099655
GeneCard ID DSG2
GenAtlas ID DSG2
HGNC ID HGNC:3049
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  9. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  10. Amanchy R, Kalume DE, Iwahori A, Zhong J, Pandey A: Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC). J Proteome Res. 2005 Sep-Oct;4(5):1661-71. [PubMed:16212419 ]
  11. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519 ]
  12. Posch MG, Posch MJ, Geier C, Erdmann B, Mueller W, Richter A, Ruppert V, Pankuweit S, Maisch B, Perrot A, Buttgereit J, Dietz R, Haverkamp W, Ozcelik C: A missense variant in desmoglein-2 predisposes to dilated cardiomyopathy. Mol Genet Metab. 2008 Sep-Oct;95(1-2):74-80. doi: 10.1016/j.ymgme.2008.06.005. Epub 2008 Aug 3. [PubMed:18678517 ]
  13. Schafer S, Koch PJ, Franke WW: Identification of the ubiquitous human desmoglein, Dsg2, and the expression catalogue of the desmoglein subfamily of desmosomal cadherins. Exp Cell Res. 1994 Apr;211(2):391-9. [PubMed:8143788 ]
  14. Koch PJ, Goldschmidt MD, Walsh MJ, Zimbelmann R, Franke WW: Complete amino acid sequence of the epidermal desmoglein precursor polypeptide and identification of a second type of desmoglein gene. Eur J Cell Biol. 1991 Aug;55(2):200-8. [PubMed:1935985 ]
  15. Awad MM, Dalal D, Cho E, Amat-Alarcon N, James C, Tichnell C, Tucker A, Russell SD, Bluemke DA, Dietz HC, Calkins H, Judge DP: DSG2 mutations contribute to arrhythmogenic right ventricular dysplasia/cardiomyopathy. Am J Hum Genet. 2006 Jul;79(1):136-42. Epub 2006 Apr 28. [PubMed:16773573 ]